Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AZT9

Protein Details
Accession D4AZT9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-68GYKMCPSCKKKSKENREKATKRETRBasic
NLS Segment(s)
PositionSequence
52-75KKKSKENREKATKRETRDKGGKKN
Subcellular Location(s) nucl 20.5, cyto_nucl 13.833, cyto 6
Family & Domain DBs
KEGG abe:ARB_01709  -  
Amino Acid Sequences MLLVYDAADSRVDSDDESDGGCIAVQAIKKKLSVVVYYISLDIGYKMCPSCKKKSKENREKATKRETRDKGGKKNVISYAKTESRKIKHGTNQTQIAKMKYELLLFLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.1
6 0.09
7 0.08
8 0.08
9 0.05
10 0.05
11 0.07
12 0.09
13 0.13
14 0.16
15 0.17
16 0.18
17 0.19
18 0.21
19 0.22
20 0.21
21 0.19
22 0.18
23 0.17
24 0.18
25 0.17
26 0.14
27 0.11
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.07
34 0.09
35 0.17
36 0.22
37 0.31
38 0.4
39 0.45
40 0.54
41 0.65
42 0.74
43 0.78
44 0.83
45 0.83
46 0.85
47 0.85
48 0.81
49 0.81
50 0.75
51 0.7
52 0.7
53 0.64
54 0.62
55 0.66
56 0.69
57 0.68
58 0.72
59 0.72
60 0.63
61 0.65
62 0.64
63 0.6
64 0.53
65 0.46
66 0.44
67 0.46
68 0.47
69 0.46
70 0.47
71 0.45
72 0.51
73 0.52
74 0.53
75 0.54
76 0.62
77 0.66
78 0.66
79 0.7
80 0.66
81 0.69
82 0.64
83 0.58
84 0.5
85 0.42
86 0.38
87 0.31
88 0.29