Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AS24

Protein Details
Accession D4AS24   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-72SPAAPKSKSARKKATKKRTAEEHSHydrophilic
NLS Segment(s)
PositionSequence
53-66PKSKSARKKATKKR
Subcellular Location(s) cyto 14.5, cyto_nucl 10, mito 6, nucl 4.5
Family & Domain DBs
KEGG abe:ARB_07039  -  
Amino Acid Sequences MITWDEKAHMKLLFAIISTSAPKVDHQAVANIMGNARIKTMVTDSNAASPAAPKSKSARKKATKKRTAEEHSDEESGDAKKVKKEHVEESESEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.12
4 0.12
5 0.13
6 0.11
7 0.1
8 0.1
9 0.1
10 0.14
11 0.16
12 0.17
13 0.17
14 0.19
15 0.18
16 0.2
17 0.21
18 0.16
19 0.14
20 0.14
21 0.14
22 0.12
23 0.11
24 0.09
25 0.08
26 0.09
27 0.11
28 0.11
29 0.11
30 0.13
31 0.13
32 0.14
33 0.15
34 0.14
35 0.12
36 0.1
37 0.11
38 0.13
39 0.13
40 0.13
41 0.17
42 0.27
43 0.36
44 0.43
45 0.52
46 0.59
47 0.69
48 0.79
49 0.85
50 0.85
51 0.83
52 0.82
53 0.82
54 0.78
55 0.76
56 0.71
57 0.65
58 0.6
59 0.54
60 0.46
61 0.36
62 0.33
63 0.25
64 0.21
65 0.19
66 0.18
67 0.22
68 0.26
69 0.33
70 0.39
71 0.43
72 0.5
73 0.55
74 0.58