Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AX15

Protein Details
Accession D4AX15    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-89DPGPAGPPRRRPRPHQKAKMRARRAERRRMKKEKEKKEEKKEEKEEEEBasic
NLS Segment(s)
PositionSequence
47-135GPPRRRPRPHQKAKMRARRAERRRMKKEKEKKEEKKEEKEEEEGRRRKRRGEGGRGGEKEEGRRRREEGGGEEGGRGEEGGKALPLRPK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
KEGG abe:ARB_00732  -  
Amino Acid Sequences MVSKKDFLMEVAKAGGEQAKANKATAAALQELVAAAAAITDDPGPAGPPRRRPRPHQKAKMRARRAERRRMKKEKEKKEEKKEEKEEEEGRRRKRRGEGGRGGEKEEGRRRREEGGGEEGGRGEEGGKALPLRPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.12
4 0.13
5 0.16
6 0.21
7 0.22
8 0.23
9 0.23
10 0.2
11 0.2
12 0.2
13 0.19
14 0.13
15 0.13
16 0.12
17 0.12
18 0.11
19 0.1
20 0.07
21 0.04
22 0.03
23 0.03
24 0.03
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.05
32 0.06
33 0.14
34 0.18
35 0.28
36 0.36
37 0.47
38 0.52
39 0.6
40 0.7
41 0.74
42 0.81
43 0.82
44 0.84
45 0.84
46 0.9
47 0.92
48 0.88
49 0.83
50 0.81
51 0.81
52 0.79
53 0.79
54 0.79
55 0.79
56 0.81
57 0.84
58 0.84
59 0.85
60 0.87
61 0.87
62 0.88
63 0.89
64 0.88
65 0.9
66 0.91
67 0.89
68 0.89
69 0.85
70 0.81
71 0.73
72 0.69
73 0.64
74 0.62
75 0.64
76 0.61
77 0.62
78 0.66
79 0.64
80 0.64
81 0.67
82 0.68
83 0.68
84 0.71
85 0.72
86 0.71
87 0.78
88 0.73
89 0.67
90 0.6
91 0.52
92 0.5
93 0.5
94 0.49
95 0.44
96 0.47
97 0.47
98 0.49
99 0.51
100 0.47
101 0.43
102 0.41
103 0.4
104 0.37
105 0.34
106 0.3
107 0.26
108 0.21
109 0.16
110 0.1
111 0.08
112 0.08
113 0.08
114 0.1
115 0.1
116 0.14