Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4B4D0

Protein Details
Accession D4B4D0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
233-256LPTSSKLRWWKAKSKGQWRTGQSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 6, cyto 5.5
Family & Domain DBs
KEGG abe:ARB_03319  -  
Amino Acid Sequences MRDPNQIASKEQVKELGAKDQKNSVSENSIQTNNENPSSNLSVDICVEAMGRISMETPPTSHQISDAASTQNHGITNIPPEELPSHPPCQARLPFRRYVSAPAVLRNRIQVTQHQVEVSRSSFTLADILSKANCRAQKPFLVRKVRARAALSMRPIPPVVRTGWETVDKSVSLAEIPEILAQDKTEGVEEMLHLRGGCGSWMGKKGNMRRLEDDEELPPMIWWLSGGKPGHSLPTSSKLRWWKAKSKGQWRTGQSRGYLQELAFVLSDGRLCRNEPGQRESEKHMEQGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.39
4 0.39
5 0.39
6 0.4
7 0.44
8 0.45
9 0.42
10 0.43
11 0.36
12 0.34
13 0.36
14 0.38
15 0.35
16 0.35
17 0.34
18 0.33
19 0.36
20 0.34
21 0.33
22 0.3
23 0.26
24 0.29
25 0.31
26 0.29
27 0.25
28 0.22
29 0.2
30 0.19
31 0.19
32 0.13
33 0.1
34 0.1
35 0.08
36 0.07
37 0.06
38 0.06
39 0.05
40 0.06
41 0.07
42 0.09
43 0.1
44 0.11
45 0.13
46 0.17
47 0.18
48 0.17
49 0.17
50 0.17
51 0.17
52 0.18
53 0.17
54 0.16
55 0.15
56 0.16
57 0.16
58 0.16
59 0.15
60 0.13
61 0.12
62 0.11
63 0.16
64 0.16
65 0.16
66 0.14
67 0.15
68 0.17
69 0.17
70 0.21
71 0.21
72 0.23
73 0.26
74 0.28
75 0.28
76 0.33
77 0.38
78 0.41
79 0.46
80 0.49
81 0.52
82 0.53
83 0.55
84 0.48
85 0.48
86 0.43
87 0.41
88 0.36
89 0.35
90 0.37
91 0.35
92 0.34
93 0.31
94 0.29
95 0.25
96 0.25
97 0.24
98 0.27
99 0.28
100 0.29
101 0.26
102 0.25
103 0.24
104 0.25
105 0.21
106 0.14
107 0.12
108 0.12
109 0.11
110 0.1
111 0.11
112 0.08
113 0.09
114 0.08
115 0.09
116 0.08
117 0.09
118 0.1
119 0.12
120 0.15
121 0.16
122 0.19
123 0.21
124 0.27
125 0.34
126 0.41
127 0.46
128 0.51
129 0.52
130 0.56
131 0.61
132 0.57
133 0.53
134 0.47
135 0.43
136 0.41
137 0.42
138 0.36
139 0.33
140 0.31
141 0.28
142 0.27
143 0.23
144 0.18
145 0.16
146 0.14
147 0.12
148 0.14
149 0.14
150 0.16
151 0.19
152 0.19
153 0.17
154 0.18
155 0.16
156 0.14
157 0.12
158 0.1
159 0.07
160 0.06
161 0.05
162 0.04
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.08
178 0.08
179 0.08
180 0.08
181 0.07
182 0.08
183 0.07
184 0.07
185 0.06
186 0.07
187 0.09
188 0.14
189 0.15
190 0.18
191 0.24
192 0.32
193 0.38
194 0.44
195 0.46
196 0.46
197 0.51
198 0.54
199 0.5
200 0.45
201 0.38
202 0.33
203 0.29
204 0.24
205 0.18
206 0.13
207 0.1
208 0.08
209 0.07
210 0.07
211 0.08
212 0.14
213 0.15
214 0.15
215 0.18
216 0.19
217 0.24
218 0.22
219 0.23
220 0.21
221 0.3
222 0.35
223 0.32
224 0.38
225 0.42
226 0.49
227 0.57
228 0.61
229 0.61
230 0.66
231 0.75
232 0.79
233 0.81
234 0.83
235 0.82
236 0.83
237 0.8
238 0.78
239 0.75
240 0.7
241 0.62
242 0.59
243 0.53
244 0.49
245 0.45
246 0.36
247 0.35
248 0.3
249 0.29
250 0.21
251 0.19
252 0.15
253 0.13
254 0.15
255 0.11
256 0.14
257 0.15
258 0.16
259 0.21
260 0.29
261 0.35
262 0.39
263 0.44
264 0.47
265 0.51
266 0.54
267 0.56
268 0.57
269 0.52
270 0.53