Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AL98

Protein Details
Accession D4AL98   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-45QEDMCSGKQRKKRSKQTTVVWLSHydrophilic
70-96ETSSLDRDIKKRRKRKKEEEKKLEAIYBasic
NLS Segment(s)
PositionSequence
78-91IKKRRKRKKEEEKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG abe:ARB_05095  -  
Amino Acid Sequences MIDTERKEKKISHRCHGYNIPSQEDMCSGKQRKKRSKQTTVVWLSIGLKKQNRHRKQYLAEKTVWETPEETSSLDRDIKKRRKRKKEEEKKLEAIYENNSVLSRPECKLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.75
4 0.7
5 0.68
6 0.64
7 0.58
8 0.48
9 0.46
10 0.38
11 0.33
12 0.3
13 0.24
14 0.29
15 0.3
16 0.35
17 0.41
18 0.51
19 0.6
20 0.67
21 0.76
22 0.77
23 0.83
24 0.84
25 0.85
26 0.85
27 0.79
28 0.69
29 0.58
30 0.48
31 0.4
32 0.34
33 0.29
34 0.23
35 0.22
36 0.26
37 0.35
38 0.45
39 0.5
40 0.56
41 0.59
42 0.61
43 0.65
44 0.71
45 0.7
46 0.63
47 0.57
48 0.5
49 0.48
50 0.44
51 0.37
52 0.27
53 0.19
54 0.16
55 0.16
56 0.16
57 0.14
58 0.11
59 0.11
60 0.13
61 0.17
62 0.19
63 0.23
64 0.33
65 0.43
66 0.52
67 0.62
68 0.71
69 0.78
70 0.86
71 0.91
72 0.92
73 0.93
74 0.95
75 0.95
76 0.93
77 0.88
78 0.79
79 0.71
80 0.62
81 0.53
82 0.45
83 0.39
84 0.31
85 0.25
86 0.23
87 0.2
88 0.2
89 0.21
90 0.21
91 0.19