Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AJW8

Protein Details
Accession D4AJW8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-160RGGQRETREKEKKRKGEKASMSKWNAGKMGRRKEKKRPEKKGAAARPSSCBasic
NLS Segment(s)
PositionSequence
101-156RKILRESEGERGGQRETREKEKKRKGEKASMSKWNAGKMGRRKEKKRPEKKGAAAR
Subcellular Location(s) mito 8, cyto_nucl 7, nucl 6.5, cyto 6.5, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abe:ARB_04568  -  
Amino Acid Sequences MVHGQRGSELLTFFTTMAHPEPDGGGIPANNRRAQLESQMLDSSDLTSHILTLESCMDSYFFTKKAEAIIIIIGVVVVVVVSIPALDPYSLPAGALITRGRKILRESEGERGGQRETREKEKKRKGEKASMSKWNAGKMGRRKEKKRPEKKGAAARPSSCSMVFKHEMKEKKRQAANSVQSPALPIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.13
4 0.14
5 0.14
6 0.13
7 0.13
8 0.13
9 0.13
10 0.14
11 0.12
12 0.11
13 0.1
14 0.14
15 0.2
16 0.24
17 0.25
18 0.25
19 0.26
20 0.28
21 0.29
22 0.31
23 0.32
24 0.28
25 0.29
26 0.29
27 0.27
28 0.25
29 0.23
30 0.17
31 0.11
32 0.11
33 0.09
34 0.08
35 0.08
36 0.07
37 0.08
38 0.06
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.1
47 0.11
48 0.11
49 0.12
50 0.12
51 0.12
52 0.13
53 0.13
54 0.11
55 0.1
56 0.09
57 0.07
58 0.07
59 0.06
60 0.04
61 0.03
62 0.03
63 0.02
64 0.01
65 0.01
66 0.01
67 0.01
68 0.01
69 0.01
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.04
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.1
87 0.1
88 0.12
89 0.14
90 0.19
91 0.21
92 0.25
93 0.26
94 0.31
95 0.33
96 0.32
97 0.3
98 0.26
99 0.24
100 0.21
101 0.2
102 0.23
103 0.24
104 0.34
105 0.43
106 0.51
107 0.6
108 0.68
109 0.76
110 0.78
111 0.84
112 0.81
113 0.82
114 0.83
115 0.83
116 0.8
117 0.79
118 0.73
119 0.69
120 0.63
121 0.55
122 0.48
123 0.41
124 0.42
125 0.42
126 0.5
127 0.54
128 0.62
129 0.67
130 0.75
131 0.83
132 0.86
133 0.88
134 0.88
135 0.88
136 0.89
137 0.91
138 0.91
139 0.89
140 0.86
141 0.82
142 0.74
143 0.68
144 0.61
145 0.54
146 0.44
147 0.37
148 0.3
149 0.31
150 0.33
151 0.32
152 0.35
153 0.41
154 0.48
155 0.52
156 0.61
157 0.62
158 0.66
159 0.7
160 0.68
161 0.68
162 0.7
163 0.74
164 0.71
165 0.66
166 0.57
167 0.51