Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AQQ7

Protein Details
Accession D4AQQ7   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
144-166QDDIERRRLLRKRARSIEREEAEBasic
NLS Segment(s)
PositionSequence
153-157LRKRA
Subcellular Location(s) mito 15, nucl 4.5, extr 4, cyto_nucl 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
KEGG abe:ARB_06567  -  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MCHKAIPPHRRFFAAPSVLGPRIQPDRIDRLDNVAGLYHHEGPYDPVTRERNALPDRAPVQALQSSNQEALNATSYDGGAGNLSQHYPLGGDAVPPPGSRDLTDRFLSFYPRTNVMVEAPAHLQRRAGFNYGDGDTLMDPYYNQDDIERRRLLRKRARSIEREEAEAADSASKKRDVNSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.37
4 0.4
5 0.37
6 0.36
7 0.31
8 0.27
9 0.27
10 0.28
11 0.28
12 0.27
13 0.34
14 0.37
15 0.4
16 0.35
17 0.36
18 0.37
19 0.34
20 0.29
21 0.22
22 0.19
23 0.18
24 0.21
25 0.18
26 0.16
27 0.16
28 0.15
29 0.17
30 0.22
31 0.22
32 0.19
33 0.22
34 0.25
35 0.26
36 0.29
37 0.26
38 0.3
39 0.29
40 0.31
41 0.27
42 0.3
43 0.3
44 0.29
45 0.29
46 0.2
47 0.21
48 0.22
49 0.21
50 0.17
51 0.17
52 0.17
53 0.17
54 0.17
55 0.14
56 0.11
57 0.11
58 0.12
59 0.1
60 0.08
61 0.08
62 0.07
63 0.08
64 0.07
65 0.06
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.1
87 0.13
88 0.15
89 0.19
90 0.2
91 0.19
92 0.2
93 0.2
94 0.24
95 0.21
96 0.23
97 0.21
98 0.22
99 0.24
100 0.22
101 0.23
102 0.19
103 0.22
104 0.17
105 0.16
106 0.15
107 0.19
108 0.19
109 0.19
110 0.19
111 0.18
112 0.22
113 0.23
114 0.23
115 0.19
116 0.19
117 0.22
118 0.21
119 0.2
120 0.15
121 0.14
122 0.11
123 0.12
124 0.11
125 0.07
126 0.07
127 0.09
128 0.12
129 0.11
130 0.11
131 0.13
132 0.19
133 0.25
134 0.32
135 0.34
136 0.33
137 0.42
138 0.49
139 0.57
140 0.61
141 0.66
142 0.69
143 0.76
144 0.83
145 0.8
146 0.82
147 0.82
148 0.74
149 0.67
150 0.57
151 0.48
152 0.4
153 0.34
154 0.26
155 0.2
156 0.19
157 0.17
158 0.19
159 0.22
160 0.22
161 0.26