Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4APP6

Protein Details
Accession D4APP6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-74ATVRTGERARRRQRQGPSLPHydrophilic
NLS Segment(s)
PositionSequence
233-254GERRGGKKRREVAETNPRPRQA
Subcellular Location(s) plas 11, mito 4, extr 3, E.R. 3, vacu 3, cyto_mito 3
Family & Domain DBs
KEGG abe:ARB_06214  -  
Amino Acid Sequences MAAARAMAGRGRAGCDGEDDAVMLALMLALTTKAWAKRCVIWIVPGECSTFLSAATVRTGERARRRQRQGPSLPAVEICLSFLAMAFGCSPGSVFFSDAAVGVVVVETSVVIDAGGRFVREREREREREREREREVRSMGGGRFESLSRPVQEEGDEKICLDDAQQAQPLALDCGSTLTLIVDPFFVLAVLVSEQLVCLTLQLFLSVLSRPGCQLADVEVEVEVEVEVEVEKGERRGGKKRREVAETNPRPRQAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.18
5 0.17
6 0.14
7 0.12
8 0.11
9 0.1
10 0.07
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.08
20 0.13
21 0.16
22 0.2
23 0.23
24 0.29
25 0.34
26 0.38
27 0.36
28 0.37
29 0.4
30 0.39
31 0.38
32 0.33
33 0.29
34 0.24
35 0.24
36 0.2
37 0.13
38 0.11
39 0.1
40 0.1
41 0.1
42 0.11
43 0.11
44 0.09
45 0.13
46 0.16
47 0.22
48 0.32
49 0.41
50 0.5
51 0.59
52 0.67
53 0.71
54 0.77
55 0.8
56 0.78
57 0.76
58 0.72
59 0.64
60 0.56
61 0.48
62 0.4
63 0.31
64 0.23
65 0.15
66 0.09
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.07
87 0.05
88 0.05
89 0.04
90 0.03
91 0.03
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.04
102 0.04
103 0.05
104 0.05
105 0.06
106 0.11
107 0.16
108 0.2
109 0.26
110 0.34
111 0.41
112 0.46
113 0.56
114 0.56
115 0.61
116 0.62
117 0.63
118 0.6
119 0.61
120 0.59
121 0.55
122 0.51
123 0.41
124 0.37
125 0.34
126 0.28
127 0.23
128 0.2
129 0.15
130 0.15
131 0.14
132 0.14
133 0.13
134 0.15
135 0.13
136 0.15
137 0.15
138 0.15
139 0.16
140 0.17
141 0.17
142 0.17
143 0.16
144 0.14
145 0.13
146 0.13
147 0.11
148 0.1
149 0.13
150 0.11
151 0.13
152 0.15
153 0.15
154 0.15
155 0.15
156 0.15
157 0.11
158 0.09
159 0.07
160 0.05
161 0.07
162 0.07
163 0.06
164 0.06
165 0.05
166 0.06
167 0.06
168 0.07
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.04
185 0.04
186 0.04
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.1
195 0.1
196 0.11
197 0.11
198 0.13
199 0.13
200 0.12
201 0.13
202 0.12
203 0.14
204 0.13
205 0.13
206 0.11
207 0.11
208 0.1
209 0.1
210 0.07
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.05
218 0.07
219 0.08
220 0.12
221 0.18
222 0.23
223 0.33
224 0.43
225 0.52
226 0.61
227 0.69
228 0.72
229 0.75
230 0.75
231 0.75
232 0.77
233 0.77
234 0.77
235 0.75
236 0.74