Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B2W7

Protein Details
Accession D4B2W7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
184-215DVCLSPKREQQKPPKNRRRRQPRSRHLLHQPPBasic
319-350RGRDHQPSSKINPQKKRKKKTNEETLKKLPFCHydrophilic
NLS Segment(s)
PositionSequence
190-208KREQQKPPKNRRRRQPRSR
328-338KINPQKKRKKK
Subcellular Location(s) plas 14, mito 8, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abe:ARB_02800  -  
Amino Acid Sequences MGVSLPPTTVAAFSWGCCWLCCRRRLVEVEELNDSDSDIIDSDADSHDDIDSDCERRPATFRRKGITYALPALFSLPPALHRFLLVPSFQPLNLTITITITITITITITITITITITITITITITITITITITITITITDPLATYPYLITSSPSVKSPPNTRLVIRINQPLISPQPASLPAGSDVCLSPKREQQKPPKNRRRRQPRSRHLLHQPPSLPLFLFLSLLLLHSCSCSYVVAVVGRIRILAVSPLPVSAGLLASPFPTHSRLPEIKRRRRAQSLVRAPVDLLGVQLATLWCGLVGALSTSTTSTTTTRPASSRGRDHQPSSKINPQKKRKKKTNEETLKKLPFCFFYFYFFSSSASCFLPCILSFYGPSSCPFLPRSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.19
4 0.19
5 0.22
6 0.28
7 0.35
8 0.4
9 0.44
10 0.45
11 0.52
12 0.58
13 0.6
14 0.6
15 0.57
16 0.55
17 0.53
18 0.48
19 0.41
20 0.35
21 0.29
22 0.19
23 0.14
24 0.11
25 0.07
26 0.07
27 0.06
28 0.06
29 0.08
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.12
38 0.14
39 0.15
40 0.16
41 0.18
42 0.18
43 0.2
44 0.25
45 0.32
46 0.4
47 0.47
48 0.52
49 0.55
50 0.58
51 0.59
52 0.59
53 0.56
54 0.5
55 0.48
56 0.43
57 0.37
58 0.34
59 0.33
60 0.27
61 0.21
62 0.17
63 0.1
64 0.13
65 0.16
66 0.18
67 0.16
68 0.16
69 0.17
70 0.18
71 0.21
72 0.18
73 0.16
74 0.16
75 0.17
76 0.17
77 0.17
78 0.16
79 0.16
80 0.16
81 0.15
82 0.13
83 0.12
84 0.13
85 0.12
86 0.11
87 0.08
88 0.07
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.12
139 0.12
140 0.13
141 0.14
142 0.16
143 0.2
144 0.24
145 0.27
146 0.31
147 0.32
148 0.32
149 0.37
150 0.39
151 0.39
152 0.38
153 0.38
154 0.33
155 0.31
156 0.31
157 0.26
158 0.23
159 0.21
160 0.17
161 0.12
162 0.12
163 0.13
164 0.14
165 0.12
166 0.11
167 0.1
168 0.1
169 0.1
170 0.09
171 0.08
172 0.1
173 0.12
174 0.14
175 0.15
176 0.19
177 0.25
178 0.31
179 0.4
180 0.48
181 0.57
182 0.65
183 0.75
184 0.81
185 0.86
186 0.87
187 0.9
188 0.9
189 0.9
190 0.91
191 0.9
192 0.9
193 0.89
194 0.87
195 0.83
196 0.81
197 0.79
198 0.72
199 0.67
200 0.58
201 0.5
202 0.46
203 0.39
204 0.3
205 0.21
206 0.18
207 0.11
208 0.1
209 0.08
210 0.07
211 0.07
212 0.07
213 0.06
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.06
220 0.05
221 0.05
222 0.06
223 0.07
224 0.07
225 0.08
226 0.09
227 0.09
228 0.09
229 0.08
230 0.08
231 0.06
232 0.06
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.07
241 0.06
242 0.06
243 0.04
244 0.04
245 0.05
246 0.05
247 0.05
248 0.06
249 0.07
250 0.1
251 0.11
252 0.12
253 0.2
254 0.27
255 0.33
256 0.43
257 0.52
258 0.59
259 0.69
260 0.75
261 0.74
262 0.77
263 0.78
264 0.78
265 0.78
266 0.78
267 0.77
268 0.71
269 0.63
270 0.54
271 0.48
272 0.38
273 0.27
274 0.17
275 0.08
276 0.07
277 0.06
278 0.07
279 0.06
280 0.05
281 0.05
282 0.05
283 0.04
284 0.04
285 0.04
286 0.03
287 0.03
288 0.04
289 0.04
290 0.05
291 0.05
292 0.06
293 0.07
294 0.07
295 0.09
296 0.1
297 0.12
298 0.16
299 0.19
300 0.22
301 0.23
302 0.29
303 0.36
304 0.42
305 0.49
306 0.51
307 0.58
308 0.6
309 0.64
310 0.67
311 0.66
312 0.66
313 0.64
314 0.67
315 0.67
316 0.7
317 0.75
318 0.77
319 0.81
320 0.85
321 0.88
322 0.89
323 0.92
324 0.94
325 0.94
326 0.95
327 0.95
328 0.93
329 0.91
330 0.9
331 0.87
332 0.78
333 0.7
334 0.62
335 0.56
336 0.49
337 0.47
338 0.38
339 0.35
340 0.36
341 0.35
342 0.35
343 0.31
344 0.29
345 0.25
346 0.25
347 0.22
348 0.2
349 0.18
350 0.15
351 0.15
352 0.17
353 0.15
354 0.18
355 0.18
356 0.18
357 0.19
358 0.22
359 0.25
360 0.22
361 0.24
362 0.25
363 0.24
364 0.26
365 0.28