Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AU84

Protein Details
Accession D4AU84    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-54LANRQGWTKKNQKYPRQWEKCLREEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 2, vacu 2
Family & Domain DBs
KEGG abe:ARB_07714  -  
Amino Acid Sequences MPHSQYFQKRDPNFQHNDNNSLRIEFGRLANRQGWTKKNQKYPRQWEKCLREEFAYHVYQIVDEHGDKLSNLKLLCERYLNETPASIVACKKALRRIHINLVDWIESQRRGDEPHLFRSEKHLQYYTREHKKYFPKKILDDVPIMKVFLRDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.65
4 0.69
5 0.61
6 0.56
7 0.48
8 0.42
9 0.35
10 0.26
11 0.25
12 0.19
13 0.21
14 0.24
15 0.24
16 0.27
17 0.29
18 0.32
19 0.35
20 0.39
21 0.4
22 0.41
23 0.5
24 0.54
25 0.62
26 0.69
27 0.73
28 0.78
29 0.83
30 0.87
31 0.85
32 0.85
33 0.85
34 0.83
35 0.81
36 0.74
37 0.66
38 0.56
39 0.48
40 0.44
41 0.38
42 0.31
43 0.23
44 0.19
45 0.17
46 0.15
47 0.14
48 0.11
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.09
56 0.09
57 0.1
58 0.1
59 0.1
60 0.13
61 0.14
62 0.15
63 0.15
64 0.15
65 0.19
66 0.22
67 0.22
68 0.2
69 0.18
70 0.17
71 0.17
72 0.17
73 0.11
74 0.08
75 0.08
76 0.11
77 0.12
78 0.14
79 0.21
80 0.24
81 0.29
82 0.36
83 0.39
84 0.46
85 0.49
86 0.48
87 0.44
88 0.42
89 0.37
90 0.3
91 0.27
92 0.2
93 0.17
94 0.16
95 0.14
96 0.14
97 0.16
98 0.19
99 0.27
100 0.28
101 0.36
102 0.41
103 0.4
104 0.4
105 0.45
106 0.51
107 0.45
108 0.47
109 0.43
110 0.39
111 0.45
112 0.55
113 0.57
114 0.59
115 0.58
116 0.55
117 0.59
118 0.68
119 0.72
120 0.73
121 0.71
122 0.7
123 0.71
124 0.78
125 0.77
126 0.7
127 0.66
128 0.58
129 0.55
130 0.47
131 0.43
132 0.34