Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B221

Protein Details
Accession D4B221    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-117GMVGLKKRDRSAKKKGKAKGKKBasic
NLS Segment(s)
PositionSequence
100-117LKKRDRSAKKKGKAKGKK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG abe:ARB_02504  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MSKPHLPNDEFLSFLESLLVKQSASSRGSVFLTQKRLQSETTSKDESQSTVSNPPMILIRASNGRHKDSKVKASTVVKPEEIEAFYRRYAEICKAGMVGLKKRDRSAKKKGKAKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.14
4 0.12
5 0.15
6 0.14
7 0.1
8 0.11
9 0.14
10 0.17
11 0.18
12 0.19
13 0.17
14 0.19
15 0.21
16 0.23
17 0.25
18 0.25
19 0.31
20 0.32
21 0.35
22 0.36
23 0.36
24 0.34
25 0.34
26 0.36
27 0.34
28 0.37
29 0.37
30 0.34
31 0.35
32 0.34
33 0.29
34 0.26
35 0.22
36 0.18
37 0.18
38 0.18
39 0.17
40 0.16
41 0.16
42 0.13
43 0.12
44 0.11
45 0.07
46 0.08
47 0.12
48 0.14
49 0.19
50 0.21
51 0.24
52 0.26
53 0.28
54 0.35
55 0.35
56 0.43
57 0.41
58 0.4
59 0.42
60 0.45
61 0.49
62 0.46
63 0.43
64 0.35
65 0.32
66 0.31
67 0.28
68 0.23
69 0.2
70 0.17
71 0.17
72 0.16
73 0.17
74 0.16
75 0.15
76 0.17
77 0.19
78 0.21
79 0.19
80 0.2
81 0.19
82 0.19
83 0.21
84 0.23
85 0.25
86 0.3
87 0.36
88 0.38
89 0.43
90 0.53
91 0.59
92 0.64
93 0.69
94 0.71
95 0.74
96 0.8
97 0.84