Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B006

Protein Details
Accession D4B006   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-93DSATPTKNRRSKKVKTESKQEVKQEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.833, mito_nucl 12.666, mito 2.5
Family & Domain DBs
KEGG abe:ARB_01777  -  
Amino Acid Sequences MPEYNVKSIQNQIWFIKTKTLGDKASGSNPSTPSKGGMKDAKTPTKSPASAKRERAEVDDAQADSVPDSATPTKNRRSKKVKTESKQEVKQEVKSEDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.38
4 0.35
5 0.34
6 0.36
7 0.39
8 0.35
9 0.34
10 0.36
11 0.32
12 0.36
13 0.35
14 0.3
15 0.28
16 0.3
17 0.3
18 0.28
19 0.26
20 0.23
21 0.23
22 0.23
23 0.25
24 0.28
25 0.28
26 0.34
27 0.4
28 0.44
29 0.44
30 0.43
31 0.42
32 0.42
33 0.41
34 0.37
35 0.41
36 0.42
37 0.46
38 0.5
39 0.48
40 0.46
41 0.45
42 0.44
43 0.38
44 0.31
45 0.26
46 0.24
47 0.22
48 0.19
49 0.18
50 0.14
51 0.1
52 0.1
53 0.07
54 0.05
55 0.08
56 0.1
57 0.14
58 0.2
59 0.25
60 0.35
61 0.42
62 0.48
63 0.55
64 0.62
65 0.68
66 0.74
67 0.79
68 0.81
69 0.82
70 0.87
71 0.87
72 0.88
73 0.86
74 0.82
75 0.8
76 0.74
77 0.72
78 0.68