Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SU76

Protein Details
Accession F2SU76   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-129GTVDKIERPSRKQRKSSKIRAKKLRGTAKVKGVKBasic
NLS Segment(s)
PositionSequence
102-133ERPSRKQRKSSKIRAKKLRGTAKVKGVKKAKK
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNPLLSRKQMVVDILHPNRANISKDDLRTKLGELYKANKDQISVFGLRTHYGGGKTTGFALVYDSTEALKKFEPRYRLVRYGTVDKIERPSRKQRKSSKIRAKKLRGTAKVKGVKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.74
5 0.79
6 0.74
7 0.69
8 0.61
9 0.54
10 0.45
11 0.4
12 0.31
13 0.26
14 0.32
15 0.31
16 0.34
17 0.32
18 0.3
19 0.32
20 0.33
21 0.31
22 0.23
23 0.29
24 0.28
25 0.31
26 0.37
27 0.35
28 0.34
29 0.33
30 0.32
31 0.3
32 0.27
33 0.28
34 0.25
35 0.29
36 0.32
37 0.34
38 0.34
39 0.28
40 0.27
41 0.23
42 0.23
43 0.21
44 0.17
45 0.14
46 0.15
47 0.16
48 0.15
49 0.15
50 0.13
51 0.11
52 0.1
53 0.11
54 0.1
55 0.1
56 0.09
57 0.1
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.14
72 0.19
73 0.24
74 0.28
75 0.31
76 0.38
77 0.44
78 0.47
79 0.46
80 0.46
81 0.46
82 0.48
83 0.46
84 0.43
85 0.37
86 0.33
87 0.38
88 0.41
89 0.42
90 0.42
91 0.51
92 0.58
93 0.66
94 0.74
95 0.77
96 0.8
97 0.86
98 0.9
99 0.91
100 0.91
101 0.92
102 0.93
103 0.92
104 0.9
105 0.9
106 0.89
107 0.87
108 0.84
109 0.81
110 0.8
111 0.8
112 0.75
113 0.74