Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SD63

Protein Details
Accession F2SD63    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-147GADTGKDYKRKNRKFKPKKERKDGTPTNTPBasic
NLS Segment(s)
PositionSequence
124-139DYKRKNRKFKPKKERK
Subcellular Location(s) nucl 16, cyto 6.5, cyto_mito 4.5, mito 1.5
Family & Domain DBs
Amino Acid Sequences MAANDSTNNAEGTNAATGPAAPAAPAVPAVPAGPSTRFYSKHAQNKGQYGRRWDSSESKLEISGPPGALNSFSGPRPAAPAAPPAASRPNPAAPPFTPAPRKWGPSPAAGASGSSSAGADTGKDYKRKNRKFKPKKERKDGTPTNTPVSDAPDGLKDTTNRRPQRRNMPGTRNPGMRRRNEEGGRSATPGANQDEPTVVEAPANDKTPAVPAQEDNAVKEQPVGTEEPKAMTPPKEEDAKPVEVNQASDAPVPKDVEVSPPKDAEDTPKPASEPAEEKAEAVPSLIKWSPIFPPGGPRPTPALNDGASGDQPKRTNYVDANGNYHAPNGTIMSAELLKLFATGKIRNSLGDKVYFMPSFIENHPPEGQQPYPLAGTPSRIFYDPRDFKKASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.11
6 0.12
7 0.09
8 0.07
9 0.07
10 0.07
11 0.08
12 0.08
13 0.07
14 0.06
15 0.07
16 0.07
17 0.07
18 0.09
19 0.11
20 0.12
21 0.15
22 0.2
23 0.25
24 0.27
25 0.31
26 0.4
27 0.47
28 0.54
29 0.61
30 0.64
31 0.65
32 0.73
33 0.78
34 0.76
35 0.72
36 0.71
37 0.68
38 0.65
39 0.62
40 0.57
41 0.55
42 0.53
43 0.55
44 0.49
45 0.44
46 0.4
47 0.38
48 0.34
49 0.3
50 0.27
51 0.2
52 0.17
53 0.16
54 0.16
55 0.15
56 0.14
57 0.14
58 0.13
59 0.13
60 0.15
61 0.15
62 0.15
63 0.19
64 0.19
65 0.19
66 0.18
67 0.22
68 0.21
69 0.23
70 0.23
71 0.21
72 0.28
73 0.26
74 0.28
75 0.27
76 0.3
77 0.31
78 0.33
79 0.35
80 0.28
81 0.33
82 0.33
83 0.36
84 0.38
85 0.35
86 0.42
87 0.41
88 0.45
89 0.42
90 0.48
91 0.44
92 0.41
93 0.44
94 0.37
95 0.35
96 0.3
97 0.27
98 0.2
99 0.17
100 0.13
101 0.1
102 0.08
103 0.05
104 0.06
105 0.05
106 0.05
107 0.06
108 0.13
109 0.16
110 0.21
111 0.25
112 0.34
113 0.46
114 0.56
115 0.65
116 0.7
117 0.78
118 0.84
119 0.92
120 0.94
121 0.94
122 0.95
123 0.95
124 0.93
125 0.89
126 0.89
127 0.86
128 0.82
129 0.8
130 0.71
131 0.64
132 0.55
133 0.48
134 0.38
135 0.34
136 0.27
137 0.18
138 0.16
139 0.15
140 0.15
141 0.15
142 0.17
143 0.14
144 0.19
145 0.27
146 0.36
147 0.42
148 0.49
149 0.56
150 0.61
151 0.7
152 0.75
153 0.76
154 0.76
155 0.78
156 0.78
157 0.78
158 0.75
159 0.7
160 0.63
161 0.62
162 0.6
163 0.56
164 0.55
165 0.53
166 0.56
167 0.52
168 0.52
169 0.47
170 0.45
171 0.4
172 0.34
173 0.3
174 0.23
175 0.21
176 0.2
177 0.18
178 0.15
179 0.14
180 0.13
181 0.13
182 0.13
183 0.13
184 0.12
185 0.1
186 0.08
187 0.08
188 0.1
189 0.11
190 0.12
191 0.1
192 0.09
193 0.09
194 0.11
195 0.13
196 0.12
197 0.11
198 0.1
199 0.12
200 0.17
201 0.17
202 0.16
203 0.16
204 0.15
205 0.14
206 0.15
207 0.13
208 0.09
209 0.1
210 0.11
211 0.1
212 0.12
213 0.12
214 0.13
215 0.13
216 0.14
217 0.14
218 0.14
219 0.16
220 0.17
221 0.19
222 0.24
223 0.24
224 0.28
225 0.3
226 0.32
227 0.3
228 0.28
229 0.29
230 0.25
231 0.25
232 0.21
233 0.17
234 0.15
235 0.16
236 0.16
237 0.13
238 0.14
239 0.14
240 0.13
241 0.14
242 0.13
243 0.19
244 0.22
245 0.25
246 0.24
247 0.24
248 0.24
249 0.24
250 0.24
251 0.23
252 0.26
253 0.29
254 0.29
255 0.3
256 0.3
257 0.3
258 0.31
259 0.27
260 0.24
261 0.2
262 0.23
263 0.22
264 0.22
265 0.22
266 0.21
267 0.18
268 0.15
269 0.14
270 0.09
271 0.13
272 0.13
273 0.14
274 0.13
275 0.15
276 0.17
277 0.19
278 0.21
279 0.16
280 0.24
281 0.3
282 0.36
283 0.35
284 0.34
285 0.36
286 0.38
287 0.39
288 0.33
289 0.3
290 0.23
291 0.24
292 0.23
293 0.2
294 0.18
295 0.18
296 0.17
297 0.19
298 0.2
299 0.2
300 0.23
301 0.24
302 0.28
303 0.27
304 0.32
305 0.35
306 0.35
307 0.38
308 0.36
309 0.36
310 0.31
311 0.29
312 0.24
313 0.16
314 0.15
315 0.12
316 0.11
317 0.09
318 0.09
319 0.1
320 0.1
321 0.1
322 0.09
323 0.08
324 0.08
325 0.08
326 0.09
327 0.1
328 0.14
329 0.17
330 0.21
331 0.26
332 0.26
333 0.29
334 0.32
335 0.34
336 0.33
337 0.33
338 0.31
339 0.29
340 0.34
341 0.31
342 0.27
343 0.24
344 0.22
345 0.23
346 0.24
347 0.3
348 0.26
349 0.31
350 0.33
351 0.32
352 0.33
353 0.35
354 0.33
355 0.28
356 0.29
357 0.27
358 0.26
359 0.25
360 0.27
361 0.22
362 0.27
363 0.25
364 0.27
365 0.27
366 0.27
367 0.29
368 0.31
369 0.41
370 0.44
371 0.49
372 0.53