Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2T1C3

Protein Details
Accession F2T1C3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPSHKSFRTKQKLAKAQKQNRPIPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYDALCCVGMVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.84
5 0.85
6 0.82
7 0.79
8 0.74
9 0.71
10 0.65
11 0.63
12 0.63
13 0.57
14 0.55
15 0.5
16 0.48
17 0.47
18 0.49
19 0.47
20 0.41
21 0.41
22 0.36
23 0.36
24 0.35
25 0.3
26 0.25
27 0.2
28 0.16