Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2T191

Protein Details
Accession F2T191   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-64AMQLSQQRRSRRHRARQRRGRGSPVLHydrophilic
NLS Segment(s)
PositionSequence
46-60RRSRRHRARQRRGRG
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MTSRSPSPDSTNNETPTLLYQRDPPAGPGIHHHRPREPAMQLSQQRRSRRHRARQRRGRGSPVLAAALRHGVDASVSARADDDNDDDVPSPSEPQLQPQPQRQLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.38
4 0.35
5 0.28
6 0.22
7 0.24
8 0.27
9 0.31
10 0.3
11 0.27
12 0.27
13 0.27
14 0.26
15 0.28
16 0.31
17 0.37
18 0.42
19 0.43
20 0.42
21 0.45
22 0.49
23 0.48
24 0.42
25 0.37
26 0.36
27 0.42
28 0.44
29 0.46
30 0.5
31 0.5
32 0.55
33 0.59
34 0.63
35 0.66
36 0.7
37 0.75
38 0.77
39 0.82
40 0.87
41 0.9
42 0.93
43 0.92
44 0.86
45 0.82
46 0.74
47 0.65
48 0.56
49 0.47
50 0.38
51 0.28
52 0.23
53 0.17
54 0.15
55 0.12
56 0.1
57 0.08
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.1
68 0.1
69 0.12
70 0.11
71 0.12
72 0.13
73 0.14
74 0.14
75 0.15
76 0.14
77 0.14
78 0.12
79 0.19
80 0.18
81 0.24
82 0.33
83 0.4
84 0.46
85 0.53