Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SYG5

Protein Details
Accession F2SYG5   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
60-83ALHPRPLAPRHLKRPRPNVSGRPLHydrophilic
NLS Segment(s)
PositionSequence
69-74RHLKRP
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013868  Cut8/Sts1_fam  
IPR038422  Cut8/Sts1_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0071630  P:nuclear protein quality control by the ubiquitin-proteasome system  
GO:0031144  P:proteasome localization  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF08559  Cut8  
Amino Acid Sequences MNSLVATPPVPPHFYETTCRSASYSMSSTNASVNRKRKAEDDSPPSDDTRMSASPSGSPALHPRPLAPRHLKRPRPNVSGRPLSLPRLMETLDTDALRSVLRSLCDRHPEIASEVMHTAPRPSVSAALEVLNNYQSTLQSSFPLGGNPSSDYAYNRVRQHLTNLLEALNDFTPHFLPPNESQPSTSLSYLDGATDIIHQLPRWTTPQHNLEKYAAYEEMSKAWCLVIREAAKRGGGIQLQYGGWDQKLAKHNETAGGKLQDAVNELNQSLGWIGGNVGNPCNSNAGSSQGDMSSIRQQLMSGTYGAGLPLKVGPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.38
4 0.41
5 0.4
6 0.39
7 0.35
8 0.32
9 0.31
10 0.3
11 0.27
12 0.23
13 0.24
14 0.25
15 0.24
16 0.28
17 0.31
18 0.32
19 0.38
20 0.44
21 0.49
22 0.52
23 0.53
24 0.52
25 0.55
26 0.57
27 0.58
28 0.59
29 0.57
30 0.58
31 0.58
32 0.55
33 0.47
34 0.38
35 0.3
36 0.27
37 0.21
38 0.19
39 0.2
40 0.2
41 0.2
42 0.22
43 0.23
44 0.18
45 0.18
46 0.23
47 0.26
48 0.29
49 0.27
50 0.29
51 0.36
52 0.39
53 0.46
54 0.49
55 0.53
56 0.6
57 0.71
58 0.77
59 0.78
60 0.85
61 0.85
62 0.83
63 0.83
64 0.8
65 0.78
66 0.77
67 0.69
68 0.65
69 0.58
70 0.53
71 0.49
72 0.41
73 0.33
74 0.27
75 0.26
76 0.19
77 0.18
78 0.18
79 0.16
80 0.15
81 0.14
82 0.12
83 0.12
84 0.12
85 0.1
86 0.09
87 0.09
88 0.1
89 0.13
90 0.17
91 0.21
92 0.27
93 0.29
94 0.29
95 0.28
96 0.28
97 0.27
98 0.27
99 0.23
100 0.18
101 0.17
102 0.15
103 0.15
104 0.13
105 0.12
106 0.09
107 0.09
108 0.09
109 0.09
110 0.11
111 0.11
112 0.12
113 0.12
114 0.12
115 0.11
116 0.11
117 0.11
118 0.09
119 0.08
120 0.07
121 0.07
122 0.06
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.08
133 0.09
134 0.09
135 0.1
136 0.09
137 0.09
138 0.1
139 0.13
140 0.16
141 0.21
142 0.22
143 0.24
144 0.25
145 0.25
146 0.27
147 0.3
148 0.28
149 0.24
150 0.23
151 0.2
152 0.18
153 0.18
154 0.16
155 0.09
156 0.08
157 0.07
158 0.07
159 0.07
160 0.07
161 0.09
162 0.07
163 0.11
164 0.12
165 0.2
166 0.22
167 0.22
168 0.22
169 0.22
170 0.26
171 0.24
172 0.22
173 0.15
174 0.13
175 0.14
176 0.13
177 0.12
178 0.08
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.07
187 0.08
188 0.1
189 0.13
190 0.15
191 0.18
192 0.25
193 0.33
194 0.4
195 0.41
196 0.42
197 0.41
198 0.4
199 0.37
200 0.32
201 0.24
202 0.17
203 0.17
204 0.14
205 0.15
206 0.15
207 0.14
208 0.12
209 0.12
210 0.13
211 0.13
212 0.13
213 0.17
214 0.21
215 0.24
216 0.26
217 0.28
218 0.26
219 0.24
220 0.24
221 0.21
222 0.19
223 0.16
224 0.15
225 0.15
226 0.15
227 0.15
228 0.16
229 0.13
230 0.11
231 0.13
232 0.13
233 0.17
234 0.26
235 0.3
236 0.31
237 0.32
238 0.34
239 0.38
240 0.39
241 0.34
242 0.33
243 0.3
244 0.27
245 0.26
246 0.26
247 0.2
248 0.21
249 0.21
250 0.17
251 0.16
252 0.16
253 0.15
254 0.14
255 0.13
256 0.1
257 0.09
258 0.06
259 0.05
260 0.06
261 0.09
262 0.12
263 0.13
264 0.14
265 0.15
266 0.16
267 0.17
268 0.19
269 0.17
270 0.15
271 0.15
272 0.19
273 0.19
274 0.19
275 0.19
276 0.16
277 0.18
278 0.17
279 0.19
280 0.21
281 0.22
282 0.22
283 0.2
284 0.2
285 0.21
286 0.23
287 0.21
288 0.15
289 0.13
290 0.13
291 0.13
292 0.13
293 0.12
294 0.09
295 0.09