Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SN95

Protein Details
Accession F2SN95    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-107GNSWKAGERKEKQRNEWKIQGGRHydrophilic
NLS Segment(s)
PositionSequence
89-98KAGERKEKQR
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MRMADSTGASKGKYRLHWCCKVRVDLLTCSGDTSQLSSFSRRTDITLDRQIRVWKAWQNVMFLLVRNKSRKLSQRTLIAHPIKGGNSWKAGERKEKQRNEWKIQGGRGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.57
4 0.66
5 0.66
6 0.7
7 0.69
8 0.67
9 0.61
10 0.56
11 0.51
12 0.44
13 0.45
14 0.38
15 0.32
16 0.28
17 0.25
18 0.2
19 0.16
20 0.15
21 0.11
22 0.12
23 0.13
24 0.15
25 0.16
26 0.16
27 0.19
28 0.17
29 0.18
30 0.19
31 0.22
32 0.25
33 0.33
34 0.34
35 0.32
36 0.34
37 0.34
38 0.31
39 0.29
40 0.27
41 0.22
42 0.22
43 0.26
44 0.26
45 0.25
46 0.24
47 0.25
48 0.21
49 0.17
50 0.19
51 0.17
52 0.21
53 0.22
54 0.24
55 0.25
56 0.31
57 0.39
58 0.44
59 0.49
60 0.5
61 0.56
62 0.58
63 0.61
64 0.63
65 0.57
66 0.49
67 0.43
68 0.39
69 0.31
70 0.29
71 0.28
72 0.22
73 0.22
74 0.22
75 0.27
76 0.31
77 0.34
78 0.42
79 0.46
80 0.55
81 0.62
82 0.69
83 0.73
84 0.78
85 0.84
86 0.82
87 0.83
88 0.81
89 0.77
90 0.75