Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SJC0

Protein Details
Accession F2SJC0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-66EKLAEKMHRKRVERMRKREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
17-62ATRQARIQAIKDRRAAKEEKERYEKLAEKMHRKRVERMRKREKRNK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MAVMKEKEKEMKEEKEATRQARIQAIKDRRAAKEEKERYEKLAEKMHRKRVERMRKREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.59
4 0.54
5 0.53
6 0.49
7 0.46
8 0.44
9 0.43
10 0.38
11 0.42
12 0.45
13 0.44
14 0.48
15 0.49
16 0.43
17 0.46
18 0.44
19 0.41
20 0.45
21 0.46
22 0.47
23 0.49
24 0.49
25 0.48
26 0.52
27 0.5
28 0.44
29 0.46
30 0.45
31 0.49
32 0.57
33 0.64
34 0.65
35 0.64
36 0.7
37 0.72
38 0.78
39 0.78
40 0.81
41 0.82
42 0.84
43 0.92
44 0.93
45 0.93
46 0.93