Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A080WP94

Protein Details
Accession A0A080WP94    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-87NSGLGVRERERRRRRRRRRRQGARERKIIIIBasic
NLS Segment(s)
PositionSequence
63-84RERERRRRRRRRRRQGARERKI
98-102KRNGK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MHMARSPFKAFQRIGTGPHRPLIKAVLSPMIVTGSVRVGNGVDPSDGASGEALNRGNSGLGVRERERRRRRRRRRRQGARERKIIIIIIIQAGAEVRKRNGKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.48
4 0.42
5 0.46
6 0.43
7 0.35
8 0.34
9 0.32
10 0.27
11 0.22
12 0.22
13 0.21
14 0.19
15 0.19
16 0.17
17 0.14
18 0.12
19 0.1
20 0.09
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.07
27 0.08
28 0.08
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.11
49 0.13
50 0.22
51 0.29
52 0.39
53 0.5
54 0.59
55 0.69
56 0.77
57 0.87
58 0.89
59 0.95
60 0.96
61 0.97
62 0.97
63 0.97
64 0.98
65 0.97
66 0.95
67 0.92
68 0.84
69 0.74
70 0.64
71 0.53
72 0.43
73 0.33
74 0.25
75 0.17
76 0.13
77 0.11
78 0.09
79 0.09
80 0.1
81 0.11
82 0.13
83 0.16
84 0.24