Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2T095

Protein Details
Accession F2T095    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-85TLVHRARGSQPFRRRGRRRHGGYBasic
NLS Segment(s)
PositionSequence
70-83GSQPFRRRGRRRHG
Subcellular Location(s) cyto 15.5, cyto_nucl 10.5, mito 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011057  Mss4-like_sf  
IPR011323  Mss4/transl-control_tumour  
IPR034737  TCTP  
IPR018105  Translational_control_tumour_p  
Pfam View protein in Pfam  
PF00838  TCTP  
PROSITE View protein in PROSITE  
PS51797  TCTP_3  
Amino Acid Sequences MIIFKDIITDDELISDAYKMQDKGVIYEVDAKRVTKGADNIRTAPLFTSFALCLGVVANRGVTLVHRARGSQPFRRRGRRRHGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.12
6 0.12
7 0.11
8 0.14
9 0.14
10 0.16
11 0.18
12 0.17
13 0.14
14 0.23
15 0.23
16 0.24
17 0.25
18 0.23
19 0.21
20 0.22
21 0.22
22 0.16
23 0.21
24 0.25
25 0.3
26 0.32
27 0.33
28 0.33
29 0.32
30 0.29
31 0.24
32 0.18
33 0.13
34 0.11
35 0.11
36 0.09
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.12
51 0.14
52 0.18
53 0.18
54 0.2
55 0.25
56 0.34
57 0.4
58 0.43
59 0.5
60 0.57
61 0.67
62 0.77
63 0.81
64 0.83
65 0.87