Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WT26

Protein Details
Accession A0A080WT26   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-102CSSAKDSPYPPCRKRNKIQRLARLALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDVGGRQGSRQRSSHPTVNIPCLPGKGDSPGPSHCSGCGLVLVVKSYCWRARASLPTARENGAVPARWLNHNHARSCSSAKDSPYPPCRKRNKIQRLARLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.54
4 0.53
5 0.58
6 0.53
7 0.47
8 0.42
9 0.36
10 0.33
11 0.25
12 0.22
13 0.19
14 0.21
15 0.21
16 0.23
17 0.25
18 0.27
19 0.28
20 0.27
21 0.23
22 0.22
23 0.19
24 0.16
25 0.13
26 0.1
27 0.09
28 0.09
29 0.1
30 0.08
31 0.08
32 0.08
33 0.11
34 0.12
35 0.12
36 0.12
37 0.13
38 0.18
39 0.23
40 0.27
41 0.29
42 0.3
43 0.32
44 0.33
45 0.32
46 0.28
47 0.23
48 0.22
49 0.19
50 0.16
51 0.14
52 0.16
53 0.17
54 0.19
55 0.21
56 0.24
57 0.31
58 0.36
59 0.37
60 0.38
61 0.38
62 0.38
63 0.4
64 0.36
65 0.33
66 0.32
67 0.34
68 0.38
69 0.39
70 0.46
71 0.52
72 0.6
73 0.6
74 0.66
75 0.73
76 0.75
77 0.82
78 0.84
79 0.85
80 0.86
81 0.89
82 0.9