Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HH21

Protein Details
Accession Q2HH21    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-86HNFVKRQPQLRTRRTRRYDYQRAKCEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 7, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF05225  HTH_psq  
Amino Acid Sequences MAIEAIGKNKNLSIRAAARLYNVPEATIRHRRTGRLRGVEDMANHLLRERDAPPVGKLWAHNFVKRQPQLRTRRTRRYDYQRAKCEDPKIIGEWFTLVQNTRAKYGIVDDDVYNFDETGFMMGIIFAGMVVTTSDGRSKAKLAQPGNREWATVIQGVNAPWAGPSLHSSSWPRNTTSPTGYRECNLPLDWRIATTDNGWTTNAVGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.36
4 0.35
5 0.34
6 0.36
7 0.37
8 0.35
9 0.31
10 0.26
11 0.25
12 0.27
13 0.32
14 0.38
15 0.37
16 0.4
17 0.43
18 0.49
19 0.56
20 0.63
21 0.65
22 0.64
23 0.64
24 0.59
25 0.59
26 0.55
27 0.47
28 0.42
29 0.35
30 0.27
31 0.24
32 0.21
33 0.18
34 0.16
35 0.19
36 0.14
37 0.17
38 0.19
39 0.2
40 0.21
41 0.22
42 0.23
43 0.22
44 0.22
45 0.2
46 0.27
47 0.28
48 0.31
49 0.32
50 0.36
51 0.44
52 0.47
53 0.49
54 0.47
55 0.54
56 0.61
57 0.68
58 0.74
59 0.73
60 0.8
61 0.8
62 0.81
63 0.81
64 0.81
65 0.82
66 0.82
67 0.82
68 0.8
69 0.78
70 0.76
71 0.71
72 0.64
73 0.56
74 0.47
75 0.4
76 0.33
77 0.29
78 0.24
79 0.19
80 0.16
81 0.13
82 0.11
83 0.1
84 0.08
85 0.11
86 0.13
87 0.14
88 0.14
89 0.14
90 0.14
91 0.13
92 0.14
93 0.12
94 0.1
95 0.11
96 0.1
97 0.1
98 0.11
99 0.12
100 0.1
101 0.09
102 0.07
103 0.06
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.04
120 0.04
121 0.06
122 0.07
123 0.09
124 0.1
125 0.11
126 0.17
127 0.21
128 0.28
129 0.32
130 0.38
131 0.41
132 0.45
133 0.5
134 0.43
135 0.39
136 0.33
137 0.3
138 0.26
139 0.23
140 0.19
141 0.14
142 0.15
143 0.15
144 0.15
145 0.13
146 0.1
147 0.07
148 0.08
149 0.07
150 0.07
151 0.1
152 0.13
153 0.14
154 0.18
155 0.22
156 0.29
157 0.37
158 0.39
159 0.39
160 0.39
161 0.44
162 0.45
163 0.47
164 0.46
165 0.44
166 0.46
167 0.45
168 0.42
169 0.4
170 0.38
171 0.35
172 0.3
173 0.29
174 0.27
175 0.29
176 0.28
177 0.26
178 0.26
179 0.24
180 0.24
181 0.21
182 0.25
183 0.23
184 0.24
185 0.24
186 0.22