Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2HEG0

Protein Details
Accession Q2HEG0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-157TKKPTPTTTKKTTKKPTHKPTTKKPTPTPTKKPTPKPTSTKKPHPTTTKKPTVKPPVNHydrophilic
NLS Segment(s)
PositionSequence
102-149KPTPTTTKKTTKKPTHKPTTKKPTPTPTKKPTPKPTSTKKPHPTTTKK
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MHHAAAMPLFSSLLLLAGLAAAAPVVNLDDKCESQTICVDAINTCGIKYGGCYDVCDLSAKPVAPPCPTTTKKPPVPTTTKVITKVTTLKPKPTTTQKTTKKPTPTTTKKTTKKPTHKPTTKKPTPTPTKKPTPKPTSTKKPHPTTTKKPTVKPPVNPDPDQKLHHLYHQSCQLQQPTSRSAGDGINECGIMYGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.03
7 0.03
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.06
14 0.06
15 0.09
16 0.12
17 0.13
18 0.15
19 0.17
20 0.16
21 0.15
22 0.18
23 0.17
24 0.15
25 0.15
26 0.14
27 0.12
28 0.14
29 0.15
30 0.12
31 0.1
32 0.11
33 0.11
34 0.1
35 0.11
36 0.12
37 0.13
38 0.13
39 0.15
40 0.15
41 0.16
42 0.17
43 0.17
44 0.14
45 0.13
46 0.16
47 0.15
48 0.15
49 0.17
50 0.19
51 0.19
52 0.21
53 0.22
54 0.28
55 0.31
56 0.36
57 0.42
58 0.49
59 0.53
60 0.58
61 0.61
62 0.59
63 0.63
64 0.6
65 0.56
66 0.52
67 0.5
68 0.46
69 0.41
70 0.34
71 0.3
72 0.33
73 0.32
74 0.37
75 0.35
76 0.38
77 0.41
78 0.43
79 0.45
80 0.49
81 0.51
82 0.48
83 0.57
84 0.59
85 0.64
86 0.68
87 0.7
88 0.68
89 0.65
90 0.66
91 0.66
92 0.67
93 0.65
94 0.69
95 0.72
96 0.71
97 0.77
98 0.8
99 0.8
100 0.81
101 0.85
102 0.86
103 0.87
104 0.88
105 0.87
106 0.87
107 0.88
108 0.85
109 0.82
110 0.78
111 0.77
112 0.8
113 0.81
114 0.8
115 0.78
116 0.81
117 0.82
118 0.85
119 0.85
120 0.83
121 0.82
122 0.81
123 0.83
124 0.83
125 0.83
126 0.84
127 0.83
128 0.83
129 0.82
130 0.84
131 0.83
132 0.82
133 0.84
134 0.84
135 0.8
136 0.78
137 0.79
138 0.8
139 0.79
140 0.76
141 0.75
142 0.75
143 0.76
144 0.73
145 0.69
146 0.66
147 0.63
148 0.58
149 0.53
150 0.49
151 0.43
152 0.47
153 0.49
154 0.43
155 0.44
156 0.5
157 0.48
158 0.44
159 0.48
160 0.47
161 0.43
162 0.45
163 0.44
164 0.39
165 0.4
166 0.38
167 0.34
168 0.31
169 0.28
170 0.28
171 0.26
172 0.24
173 0.22
174 0.21
175 0.2