Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SWV5

Protein Details
Accession F2SWV5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
189-209NKDKEGKSKRGDEKNKKSLIFBasic
NLS Segment(s)
PositionSequence
173-205GDKKKDGEKKDDDKKGNKDKEGKSKRGDEKNKK
Subcellular Location(s) extr 10, E.R. 4, mito 3, golg 3, nucl 2, cyto 2, cyto_nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018939  Autophagy-rel_prot_27  
IPR009011  Man6P_isomerase_rcpt-bd_dom_sf  
IPR044865  MRH_dom  
Gene Ontology GO:0030659  C:cytoplasmic vesicle membrane  
GO:0000139  C:Golgi membrane  
Pfam View protein in Pfam  
PF09451  ATG27  
PROSITE View protein in PROSITE  
PS51914  MRH  
Amino Acid Sequences MARYKGLSILSLFAVFSSLASAELDCSNIKVDGVSWNFGKLGGAHSISETSSSHEGYNTTYTLDICKPLTKSLCKKGAFVCAVRNATDINGIERTMDVIDIAGNFVLNSGRTLDPIFTRLKQEDPNTEGLKMELHGGKHKFGNLLKRQKAVITLLCDRERTGLEGLEDPKPDGDKKKDGEKKDDDKKGNKDKEGKSKRGDEKNKKSLIFKSYNEEHGTLDLEWRTKYACENVEDGGSAPSSHWGFFTWVIVLLFLCTSAYLIFGSWLNYSRYGARGWDLLPHSDTIRDIPYILRDWARRVVNTLQGGGTRGGYSAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.08
5 0.07
6 0.07
7 0.08
8 0.08
9 0.09
10 0.09
11 0.11
12 0.1
13 0.1
14 0.11
15 0.11
16 0.11
17 0.09
18 0.1
19 0.16
20 0.19
21 0.21
22 0.2
23 0.21
24 0.21
25 0.21
26 0.21
27 0.13
28 0.14
29 0.14
30 0.15
31 0.14
32 0.15
33 0.16
34 0.15
35 0.16
36 0.14
37 0.14
38 0.15
39 0.16
40 0.15
41 0.15
42 0.16
43 0.17
44 0.19
45 0.15
46 0.14
47 0.14
48 0.13
49 0.16
50 0.17
51 0.17
52 0.15
53 0.19
54 0.2
55 0.25
56 0.31
57 0.36
58 0.43
59 0.5
60 0.57
61 0.54
62 0.56
63 0.54
64 0.57
65 0.52
66 0.45
67 0.41
68 0.39
69 0.4
70 0.37
71 0.34
72 0.25
73 0.22
74 0.24
75 0.19
76 0.14
77 0.14
78 0.13
79 0.13
80 0.12
81 0.13
82 0.09
83 0.08
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.04
95 0.05
96 0.08
97 0.08
98 0.09
99 0.09
100 0.1
101 0.11
102 0.14
103 0.16
104 0.14
105 0.18
106 0.19
107 0.21
108 0.25
109 0.28
110 0.29
111 0.3
112 0.34
113 0.31
114 0.31
115 0.27
116 0.22
117 0.2
118 0.15
119 0.15
120 0.11
121 0.11
122 0.17
123 0.18
124 0.19
125 0.2
126 0.21
127 0.21
128 0.22
129 0.31
130 0.34
131 0.43
132 0.44
133 0.45
134 0.44
135 0.41
136 0.4
137 0.33
138 0.27
139 0.22
140 0.22
141 0.25
142 0.25
143 0.25
144 0.23
145 0.22
146 0.19
147 0.17
148 0.14
149 0.11
150 0.11
151 0.13
152 0.15
153 0.15
154 0.15
155 0.13
156 0.13
157 0.14
158 0.15
159 0.18
160 0.2
161 0.24
162 0.26
163 0.37
164 0.43
165 0.45
166 0.51
167 0.54
168 0.59
169 0.62
170 0.68
171 0.64
172 0.65
173 0.71
174 0.73
175 0.7
176 0.67
177 0.67
178 0.65
179 0.7
180 0.72
181 0.69
182 0.64
183 0.68
184 0.71
185 0.72
186 0.76
187 0.76
188 0.78
189 0.81
190 0.81
191 0.74
192 0.69
193 0.64
194 0.61
195 0.56
196 0.48
197 0.46
198 0.43
199 0.46
200 0.44
201 0.39
202 0.31
203 0.26
204 0.26
205 0.19
206 0.18
207 0.15
208 0.14
209 0.13
210 0.13
211 0.13
212 0.12
213 0.14
214 0.17
215 0.19
216 0.2
217 0.22
218 0.22
219 0.22
220 0.21
221 0.2
222 0.15
223 0.11
224 0.09
225 0.08
226 0.11
227 0.11
228 0.11
229 0.11
230 0.11
231 0.13
232 0.14
233 0.15
234 0.11
235 0.12
236 0.12
237 0.12
238 0.1
239 0.09
240 0.08
241 0.07
242 0.06
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.06
250 0.07
251 0.09
252 0.1
253 0.13
254 0.14
255 0.15
256 0.17
257 0.18
258 0.19
259 0.18
260 0.19
261 0.18
262 0.19
263 0.18
264 0.23
265 0.23
266 0.25
267 0.25
268 0.25
269 0.24
270 0.23
271 0.23
272 0.19
273 0.19
274 0.17
275 0.16
276 0.16
277 0.19
278 0.21
279 0.23
280 0.27
281 0.27
282 0.31
283 0.38
284 0.4
285 0.37
286 0.39
287 0.41
288 0.43
289 0.43
290 0.4
291 0.34
292 0.31
293 0.32
294 0.28
295 0.24
296 0.17