Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WHP4

Protein Details
Accession A0A080WHP4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-57GAVPVQQPSKKKKKKRSKGAKGGDEYDBasic
NLS Segment(s)
PositionSequence
39-51SKKKKKKRSKGAK
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MAASVTLQDMPAGSNKRKRVEEEDGAENTSGAVPVQQPSKKKKKKRSKGAKGGDEYDANKVMGKDGGIDESIGKMDGKLLGDYFVQRIKRHNKNLTAVELDDFYIPGRLKFCSIRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.46
4 0.49
5 0.53
6 0.55
7 0.58
8 0.59
9 0.57
10 0.56
11 0.5
12 0.48
13 0.43
14 0.34
15 0.25
16 0.18
17 0.13
18 0.07
19 0.06
20 0.06
21 0.08
22 0.14
23 0.17
24 0.23
25 0.32
26 0.44
27 0.53
28 0.62
29 0.71
30 0.76
31 0.84
32 0.9
33 0.92
34 0.92
35 0.93
36 0.93
37 0.9
38 0.81
39 0.73
40 0.64
41 0.54
42 0.44
43 0.35
44 0.26
45 0.18
46 0.15
47 0.13
48 0.11
49 0.09
50 0.08
51 0.07
52 0.06
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.1
70 0.11
71 0.14
72 0.17
73 0.17
74 0.26
75 0.35
76 0.44
77 0.53
78 0.6
79 0.62
80 0.67
81 0.7
82 0.66
83 0.6
84 0.51
85 0.42
86 0.34
87 0.28
88 0.21
89 0.16
90 0.12
91 0.14
92 0.13
93 0.14
94 0.15
95 0.15
96 0.19
97 0.22