Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WLL9

Protein Details
Accession A0A080WLL9   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-33AISQEKKREIFRKQSKWKVKSHISCRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MWPIHRLAISQEKKREIFRKQSKWKVKSHISCRIFHGHVGTEEEERLGFPFCFPLNCSHPSASCLLYPVKTKMKVGHCSSRLLRGTIGQNIYLASHRTQQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.61
4 0.65
5 0.67
6 0.71
7 0.76
8 0.84
9 0.86
10 0.85
11 0.84
12 0.82
13 0.82
14 0.81
15 0.79
16 0.79
17 0.72
18 0.67
19 0.64
20 0.61
21 0.51
22 0.43
23 0.36
24 0.27
25 0.24
26 0.25
27 0.21
28 0.16
29 0.15
30 0.14
31 0.12
32 0.1
33 0.09
34 0.08
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.09
41 0.13
42 0.15
43 0.18
44 0.21
45 0.2
46 0.2
47 0.21
48 0.22
49 0.19
50 0.15
51 0.15
52 0.13
53 0.15
54 0.17
55 0.2
56 0.25
57 0.26
58 0.27
59 0.33
60 0.39
61 0.46
62 0.49
63 0.54
64 0.49
65 0.54
66 0.54
67 0.56
68 0.5
69 0.43
70 0.38
71 0.33
72 0.36
73 0.35
74 0.35
75 0.27
76 0.25
77 0.24
78 0.24
79 0.22
80 0.2
81 0.16
82 0.2