Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SZI1

Protein Details
Accession F2SZI1   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-117DEDQPKQQQQQQQRRRHCRRQTANIRAASNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 8
Family & Domain DBs
Amino Acid Sequences MPCRQLLTGGALSQRARGPSLPPATRPPAMRGRSSAPGVMLFGRCKLEAGEKREINKSRRRFRDYLTLLGLAPVAPQPRIKTNMTKFDEDQPKQQQQQQQRRRHCRRQTANIRAASNLRQARGGYRHEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.21
4 0.21
5 0.22
6 0.27
7 0.36
8 0.35
9 0.36
10 0.41
11 0.44
12 0.47
13 0.45
14 0.43
15 0.43
16 0.44
17 0.43
18 0.41
19 0.4
20 0.41
21 0.4
22 0.35
23 0.27
24 0.24
25 0.22
26 0.21
27 0.18
28 0.13
29 0.13
30 0.14
31 0.13
32 0.13
33 0.13
34 0.2
35 0.24
36 0.3
37 0.36
38 0.37
39 0.4
40 0.47
41 0.52
42 0.49
43 0.52
44 0.56
45 0.57
46 0.64
47 0.69
48 0.63
49 0.61
50 0.65
51 0.59
52 0.53
53 0.45
54 0.38
55 0.3
56 0.27
57 0.24
58 0.13
59 0.1
60 0.08
61 0.07
62 0.07
63 0.09
64 0.1
65 0.14
66 0.19
67 0.21
68 0.28
69 0.33
70 0.43
71 0.45
72 0.47
73 0.45
74 0.5
75 0.58
76 0.51
77 0.53
78 0.51
79 0.54
80 0.54
81 0.57
82 0.55
83 0.55
84 0.65
85 0.67
86 0.69
87 0.73
88 0.81
89 0.87
90 0.91
91 0.9
92 0.9
93 0.9
94 0.92
95 0.92
96 0.91
97 0.88
98 0.84
99 0.75
100 0.66
101 0.6
102 0.52
103 0.5
104 0.44
105 0.36
106 0.33
107 0.33
108 0.38
109 0.4