Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SEY4

Protein Details
Accession F2SEY4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-30ETWIQKYLYPSPNKRKIRFRVLGRLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001441  UPP_synth-like  
IPR018520  UPP_synth-like_CS  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
Pfam View protein in Pfam  
PF01255  Prenyltransf  
PROSITE View protein in PROSITE  
PS01066  UPP_SYNTHASE  
CDD cd00475  Cis_IPPS  
Amino Acid Sequences MDISETWIQKYLYPSPNKRKIRFRVLGRLELLPEKIRKLIEKLTEKTADFDEGTFNVCFPYTSRDEIARAIEMTVRNHNDSPENVENITAEAIDSNMDICNDPPLDVLIRTSGVCRLSDFLLWQCHRDTVIEVLNIHWPEFRYWHLFLAVLGWQRKKMATVDLYAGATGEPRDLWDSISNHHFKWLMSIILLLVPAAWGYHMAFYPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.72
4 0.79
5 0.82
6 0.83
7 0.84
8 0.85
9 0.84
10 0.81
11 0.82
12 0.78
13 0.77
14 0.69
15 0.62
16 0.53
17 0.47
18 0.41
19 0.35
20 0.31
21 0.27
22 0.27
23 0.27
24 0.27
25 0.29
26 0.33
27 0.37
28 0.44
29 0.45
30 0.48
31 0.5
32 0.48
33 0.45
34 0.4
35 0.33
36 0.25
37 0.22
38 0.18
39 0.14
40 0.16
41 0.14
42 0.12
43 0.1
44 0.1
45 0.1
46 0.09
47 0.14
48 0.14
49 0.17
50 0.19
51 0.2
52 0.21
53 0.22
54 0.23
55 0.18
56 0.15
57 0.13
58 0.14
59 0.15
60 0.16
61 0.2
62 0.21
63 0.22
64 0.22
65 0.23
66 0.22
67 0.21
68 0.27
69 0.23
70 0.22
71 0.2
72 0.2
73 0.18
74 0.17
75 0.16
76 0.08
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.07
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.07
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.11
107 0.12
108 0.18
109 0.18
110 0.2
111 0.19
112 0.19
113 0.19
114 0.18
115 0.17
116 0.13
117 0.15
118 0.15
119 0.14
120 0.14
121 0.19
122 0.18
123 0.17
124 0.15
125 0.13
126 0.13
127 0.15
128 0.17
129 0.17
130 0.18
131 0.19
132 0.19
133 0.18
134 0.17
135 0.17
136 0.17
137 0.17
138 0.19
139 0.19
140 0.2
141 0.21
142 0.21
143 0.22
144 0.2
145 0.22
146 0.21
147 0.22
148 0.24
149 0.24
150 0.24
151 0.22
152 0.2
153 0.13
154 0.12
155 0.1
156 0.08
157 0.06
158 0.07
159 0.1
160 0.1
161 0.12
162 0.18
163 0.19
164 0.22
165 0.31
166 0.31
167 0.29
168 0.33
169 0.32
170 0.26
171 0.3
172 0.29
173 0.22
174 0.19
175 0.2
176 0.16
177 0.16
178 0.16
179 0.1
180 0.07
181 0.06
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.08