Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WGX4

Protein Details
Accession A0A080WGX4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-36IQKAHTYKESRRWEKRERQRVGAPHydrophilic
NLS Segment(s)
PositionSequence
22-51SRRWEKRERQRVGAPAALPGGQGRRKRAPG
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MNELACLEKVALIQKAHTYKESRRWEKRERQRVGAPAALPGGQGRRKRAPGGGGLGGEPVTSSPLTSQSASLVSTQRVYARCTSDTCRLQSSTEMAASIAFSTRLHPQAWPGGTDISRAGAVMAPASRMANLTTLPEESGQLDRLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.31
4 0.34
5 0.36
6 0.38
7 0.48
8 0.57
9 0.61
10 0.66
11 0.73
12 0.79
13 0.84
14 0.88
15 0.88
16 0.83
17 0.81
18 0.77
19 0.75
20 0.69
21 0.62
22 0.51
23 0.42
24 0.37
25 0.29
26 0.23
27 0.17
28 0.18
29 0.2
30 0.23
31 0.27
32 0.33
33 0.36
34 0.38
35 0.4
36 0.37
37 0.35
38 0.36
39 0.32
40 0.25
41 0.23
42 0.21
43 0.18
44 0.14
45 0.1
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.09
53 0.09
54 0.1
55 0.09
56 0.1
57 0.1
58 0.11
59 0.1
60 0.09
61 0.09
62 0.1
63 0.12
64 0.13
65 0.14
66 0.16
67 0.18
68 0.19
69 0.21
70 0.25
71 0.3
72 0.32
73 0.32
74 0.32
75 0.3
76 0.29
77 0.28
78 0.26
79 0.19
80 0.16
81 0.14
82 0.12
83 0.11
84 0.1
85 0.09
86 0.06
87 0.05
88 0.05
89 0.07
90 0.11
91 0.13
92 0.14
93 0.14
94 0.16
95 0.23
96 0.23
97 0.23
98 0.2
99 0.21
100 0.21
101 0.21
102 0.19
103 0.14
104 0.13
105 0.12
106 0.11
107 0.08
108 0.08
109 0.09
110 0.09
111 0.08
112 0.09
113 0.1
114 0.09
115 0.09
116 0.1
117 0.1
118 0.1
119 0.12
120 0.13
121 0.14
122 0.15
123 0.14
124 0.15
125 0.15
126 0.17
127 0.16