Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WJJ0

Protein Details
Accession A0A080WJJ0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-58SATSVARRRRSLKPKVRPPRVRRRSLVPHydrophilic
NLS Segment(s)
PositionSequence
36-55ARRRRSLKPKVRPPRVRRRS
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRPSPRLTRLPLLQLMLLFPASRRSAVHRSSATSVARRRRSLKPKVRPPRVRRRSLVPSPNSSVSPARLSRRIRSLLPTQSPRLSPLQRSLPRRLQLLPPPPSRLPTVKIPRSPRPPLPLSPLLLLPPNPCPLPHEEQTPGRAPLKSKSGGTSGICTVLVCLQHNDINRTNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.24
4 0.2
5 0.14
6 0.11
7 0.14
8 0.14
9 0.15
10 0.16
11 0.22
12 0.3
13 0.32
14 0.4
15 0.36
16 0.39
17 0.42
18 0.46
19 0.42
20 0.42
21 0.46
22 0.48
23 0.53
24 0.54
25 0.57
26 0.61
27 0.68
28 0.72
29 0.75
30 0.76
31 0.8
32 0.86
33 0.92
34 0.92
35 0.92
36 0.92
37 0.91
38 0.89
39 0.81
40 0.79
41 0.77
42 0.76
43 0.76
44 0.69
45 0.65
46 0.6
47 0.59
48 0.5
49 0.43
50 0.35
51 0.27
52 0.27
53 0.25
54 0.25
55 0.3
56 0.33
57 0.34
58 0.39
59 0.4
60 0.36
61 0.38
62 0.4
63 0.4
64 0.43
65 0.43
66 0.39
67 0.39
68 0.38
69 0.36
70 0.34
71 0.3
72 0.25
73 0.26
74 0.33
75 0.37
76 0.41
77 0.45
78 0.47
79 0.47
80 0.47
81 0.44
82 0.4
83 0.42
84 0.46
85 0.46
86 0.42
87 0.46
88 0.44
89 0.44
90 0.42
91 0.37
92 0.31
93 0.34
94 0.41
95 0.42
96 0.48
97 0.53
98 0.59
99 0.65
100 0.67
101 0.63
102 0.6
103 0.58
104 0.54
105 0.55
106 0.51
107 0.44
108 0.4
109 0.35
110 0.29
111 0.26
112 0.24
113 0.18
114 0.17
115 0.18
116 0.17
117 0.17
118 0.18
119 0.23
120 0.28
121 0.29
122 0.31
123 0.33
124 0.36
125 0.4
126 0.41
127 0.39
128 0.35
129 0.35
130 0.33
131 0.34
132 0.37
133 0.36
134 0.34
135 0.33
136 0.33
137 0.36
138 0.35
139 0.33
140 0.28
141 0.26
142 0.24
143 0.21
144 0.19
145 0.17
146 0.17
147 0.16
148 0.17
149 0.18
150 0.22
151 0.26
152 0.31