Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SJ97

Protein Details
Accession F2SJ97    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPLTLSPRRPRKKRRALSGSGLTTHydrophilic
NLS Segment(s)
PositionSequence
9-16RRPRKKRR
Subcellular Location(s) mito 12, plas 6, mito_nucl 6, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004856  Glyco_trans_ALG6/ALG8  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0042283  F:dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase activity  
GO:0042281  F:dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF03155  Alg6_Alg8  
Amino Acid Sequences MAPLTLSPRRPRKKRRALSGSGLTTDLVVSKGQDTYAPAFPLVSFFWPARSGVSQWLILPVVLMIVGLFRWGTSLWGHSGYGVPPMHGDFEAQRHWMELTIHLPTSWWYFYDLQYWGLDYPPLTAYHSWLLGKMYVPNTTTTSQHGRARV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.88
5 0.86
6 0.84
7 0.76
8 0.66
9 0.57
10 0.45
11 0.36
12 0.28
13 0.2
14 0.11
15 0.08
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.11
22 0.14
23 0.17
24 0.17
25 0.16
26 0.16
27 0.15
28 0.16
29 0.15
30 0.12
31 0.11
32 0.11
33 0.12
34 0.13
35 0.13
36 0.13
37 0.14
38 0.14
39 0.15
40 0.17
41 0.16
42 0.15
43 0.16
44 0.14
45 0.13
46 0.11
47 0.07
48 0.05
49 0.04
50 0.04
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.04
60 0.05
61 0.06
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.12
69 0.11
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.11
76 0.07
77 0.1
78 0.11
79 0.12
80 0.12
81 0.11
82 0.12
83 0.13
84 0.12
85 0.11
86 0.12
87 0.13
88 0.13
89 0.12
90 0.12
91 0.12
92 0.14
93 0.12
94 0.11
95 0.13
96 0.14
97 0.15
98 0.19
99 0.19
100 0.18
101 0.17
102 0.18
103 0.15
104 0.14
105 0.13
106 0.1
107 0.11
108 0.11
109 0.11
110 0.13
111 0.13
112 0.16
113 0.17
114 0.2
115 0.18
116 0.18
117 0.18
118 0.17
119 0.18
120 0.2
121 0.2
122 0.21
123 0.22
124 0.23
125 0.26
126 0.26
127 0.27
128 0.27
129 0.32
130 0.36