Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WKS1

Protein Details
Accession A0A080WKS1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28PSNPRDRYGSKRPRSRSPPPHAPPEKLBasic
NLS Segment(s)
PositionSequence
12-22KRPRSRSPPPH
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018816  Cactin_central  
Pfam View protein in Pfam  
PF10312  Cactin_mid  
Amino Acid Sequences MPSNPRDRYGSKRPRSRSPPPHAPPEKLRHIDSQQWYAGRSRGQGSANRGAWNLKEQTRLNQLQEDEKMREWVAQEDTFVLRQAKKKAELRVKDGRAKPIDWLTITLRVIDPTRNPLDDEIADSELDLVEPEGVFEGLSNAQLSSLEKDIDTFLSLETSADNRDYWKVNHIIREICTSLSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.85
4 0.85
5 0.84
6 0.85
7 0.81
8 0.85
9 0.8
10 0.78
11 0.76
12 0.73
13 0.73
14 0.66
15 0.63
16 0.59
17 0.58
18 0.6
19 0.56
20 0.53
21 0.47
22 0.43
23 0.42
24 0.37
25 0.35
26 0.28
27 0.26
28 0.23
29 0.24
30 0.26
31 0.3
32 0.34
33 0.39
34 0.39
35 0.38
36 0.36
37 0.33
38 0.31
39 0.31
40 0.29
41 0.23
42 0.28
43 0.27
44 0.32
45 0.39
46 0.41
47 0.37
48 0.36
49 0.35
50 0.33
51 0.35
52 0.33
53 0.27
54 0.25
55 0.25
56 0.21
57 0.21
58 0.18
59 0.18
60 0.17
61 0.15
62 0.15
63 0.14
64 0.15
65 0.14
66 0.14
67 0.13
68 0.13
69 0.17
70 0.21
71 0.24
72 0.29
73 0.34
74 0.41
75 0.47
76 0.48
77 0.51
78 0.55
79 0.56
80 0.58
81 0.55
82 0.54
83 0.48
84 0.45
85 0.4
86 0.34
87 0.31
88 0.23
89 0.24
90 0.18
91 0.2
92 0.2
93 0.18
94 0.16
95 0.15
96 0.16
97 0.15
98 0.14
99 0.16
100 0.18
101 0.18
102 0.18
103 0.18
104 0.19
105 0.18
106 0.19
107 0.15
108 0.14
109 0.13
110 0.12
111 0.11
112 0.09
113 0.08
114 0.06
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.06
124 0.05
125 0.06
126 0.07
127 0.06
128 0.06
129 0.07
130 0.09
131 0.1
132 0.11
133 0.11
134 0.1
135 0.11
136 0.12
137 0.13
138 0.12
139 0.1
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.1
147 0.11
148 0.11
149 0.13
150 0.16
151 0.2
152 0.2
153 0.26
154 0.31
155 0.34
156 0.4
157 0.42
158 0.43
159 0.42
160 0.46
161 0.41