Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WPW8

Protein Details
Accession A0A080WPW8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
49-71ATFPRLIRSRKPKTKRIHRGIIKBasic
NLS Segment(s)
PositionSequence
55-67IRSRKPKTKRIHR
Subcellular Location(s) mito 15, nucl 5, plas 5
Family & Domain DBs
Amino Acid Sequences MLIQVDGANFFSRILLGISIRTYGTKKTWTATLNWFPLSFNSSIIPKTATFPRLIRSRKPKTKRIHRGIIKLISTLRIIFFSAWGDMFPSPAGPHSEPDPSTTIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.1
5 0.1
6 0.11
7 0.11
8 0.13
9 0.13
10 0.15
11 0.17
12 0.21
13 0.21
14 0.23
15 0.27
16 0.27
17 0.29
18 0.35
19 0.38
20 0.36
21 0.35
22 0.33
23 0.29
24 0.28
25 0.27
26 0.19
27 0.14
28 0.12
29 0.12
30 0.12
31 0.12
32 0.13
33 0.1
34 0.12
35 0.15
36 0.15
37 0.16
38 0.17
39 0.21
40 0.28
41 0.3
42 0.35
43 0.42
44 0.52
45 0.6
46 0.66
47 0.7
48 0.73
49 0.81
50 0.85
51 0.83
52 0.83
53 0.8
54 0.8
55 0.78
56 0.73
57 0.63
58 0.53
59 0.45
60 0.37
61 0.31
62 0.24
63 0.17
64 0.12
65 0.12
66 0.1
67 0.11
68 0.1
69 0.1
70 0.1
71 0.09
72 0.1
73 0.09
74 0.1
75 0.09
76 0.09
77 0.09
78 0.11
79 0.17
80 0.16
81 0.19
82 0.21
83 0.27
84 0.26
85 0.29