Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WKW2

Protein Details
Accession A0A080WKW2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-43YQAAKTKRGKGKGKEKKDKDDSTBasic
NLS Segment(s)
PositionSequence
25-39KTKRGKGKGKEKKDK
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MAEDTVAEGAAETSALQSQPYQAAKTKRGKGKGKEKKDKDDSTPPVKRRCVSTACIACRKRKSKVCLPIIASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.08
6 0.13
7 0.15
8 0.16
9 0.2
10 0.26
11 0.33
12 0.42
13 0.48
14 0.5
15 0.58
16 0.64
17 0.68
18 0.74
19 0.76
20 0.78
21 0.81
22 0.8
23 0.81
24 0.81
25 0.76
26 0.7
27 0.7
28 0.65
29 0.65
30 0.67
31 0.62
32 0.61
33 0.62
34 0.57
35 0.52
36 0.52
37 0.46
38 0.42
39 0.47
40 0.48
41 0.5
42 0.58
43 0.57
44 0.59
45 0.65
46 0.68
47 0.68
48 0.68
49 0.71
50 0.72
51 0.78
52 0.78
53 0.77