Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WFF4

Protein Details
Accession A0A080WFF4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-106REQTPCFYILKRNRKKQQLEPAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLKLLQYLFGVRDISPNQTCGAAQAPGMRVASCLIKEHCCSNTTAESESFIPDIVIQRSRFPCTTCTRINIVCDRSYPRCAHCLREQTPCFYILKRNRKKQQLEPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.23
5 0.22
6 0.22
7 0.18
8 0.19
9 0.12
10 0.12
11 0.14
12 0.15
13 0.16
14 0.17
15 0.15
16 0.13
17 0.14
18 0.15
19 0.12
20 0.15
21 0.14
22 0.17
23 0.18
24 0.21
25 0.21
26 0.2
27 0.21
28 0.21
29 0.22
30 0.2
31 0.21
32 0.18
33 0.18
34 0.17
35 0.17
36 0.13
37 0.1
38 0.08
39 0.07
40 0.09
41 0.09
42 0.12
43 0.12
44 0.16
45 0.18
46 0.22
47 0.22
48 0.22
49 0.26
50 0.28
51 0.34
52 0.31
53 0.33
54 0.34
55 0.35
56 0.37
57 0.38
58 0.35
59 0.3
60 0.31
61 0.33
62 0.33
63 0.37
64 0.35
65 0.32
66 0.36
67 0.37
68 0.4
69 0.43
70 0.48
71 0.47
72 0.55
73 0.55
74 0.52
75 0.52
76 0.48
77 0.42
78 0.34
79 0.4
80 0.4
81 0.49
82 0.55
83 0.64
84 0.72
85 0.8
86 0.87