Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2T043

Protein Details
Accession F2T043    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKRMVMILKNRKKRRGTFVYRNAGIHydrophilic
NLS Segment(s)
PositionSequence
12-13KK
Subcellular Location(s) mito 17, mito_nucl 13.666, nucl 8, cyto_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MKRMVMILKNRKKRRGTFVYRNAGIMEDPLDKLWGQEHGTVTGNRLVHNLLGPLPCLKLYLSIWISSLNLANLTTLDTSTDTETARSEWCIGPLVSGGLPSSRLPAYTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.83
5 0.84
6 0.85
7 0.77
8 0.7
9 0.59
10 0.49
11 0.39
12 0.28
13 0.2
14 0.12
15 0.11
16 0.11
17 0.11
18 0.1
19 0.1
20 0.11
21 0.11
22 0.11
23 0.14
24 0.15
25 0.16
26 0.18
27 0.18
28 0.19
29 0.19
30 0.18
31 0.15
32 0.15
33 0.13
34 0.11
35 0.11
36 0.1
37 0.09
38 0.08
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.08
46 0.08
47 0.13
48 0.13
49 0.13
50 0.14
51 0.14
52 0.14
53 0.12
54 0.12
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.11
68 0.1
69 0.1
70 0.11
71 0.12
72 0.12
73 0.12
74 0.14
75 0.13
76 0.14
77 0.16
78 0.15
79 0.15
80 0.14
81 0.14
82 0.12
83 0.11
84 0.11
85 0.08
86 0.11
87 0.1
88 0.13
89 0.12
90 0.13