Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SZG8

Protein Details
Accession F2SZG8    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-150SGDIKRPYPKLKRFDPKKTEIPRSBasic
440-459PNCRGQLWPAKRKTTRPGEDHydrophilic
NLS Segment(s)
PositionSequence
133-160PYPKLKRFDPKKTEIPRSGERYIPPKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003616  Post-SET_dom  
IPR007728  Pre-SET_dom  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0008270  F:zinc ion binding  
GO:0034968  P:histone lysine methylation  
Pfam View protein in Pfam  
PF05033  Pre-SET  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50868  POST_SET  
PS50280  SET  
Amino Acid Sequences MVTVLDSDSDEETLIQPEVISGRLLKAFISPDDDRRRHSLSRPPSQPGRAVVDKGSTSSSSRPQSKASNVSVVISVPLRRPSPSPATTSRKRSLSSDGDINKALSQKPTATKIPDHHGLSDFYAVGSGDIKRPYPKLKRFDPKKTEIPRSGERYIPPKRRSDKESACSRLEELYNKKLQRIKGPPIQFKASKIAKEINFNFDFIDSYKIHSGVNQIDPEFLWGCDCTKCDAECDCLSKDLIHYEKGQRVRAVLKSEILNKRTALIRECSSRCKCSAVKCWNHVVFRGRKVELEIFQTKNRGFGVRSPHFIERGQFIDTYVGEVIEPSTSDAREEAIDVEKYSSYLFSLDYFPVEEDEKDKDIYVVDGRKFGSITRFMNHSCNPNCKMFPVTQTDDHRVYHLAFFAVRDIPAGTELTFDYHPGWEGGDVDPDATKCLCGEPNCRGQLWPAKRKTTRPGEDSSSSGESSGESEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.1
5 0.11
6 0.11
7 0.11
8 0.1
9 0.12
10 0.14
11 0.14
12 0.13
13 0.16
14 0.18
15 0.18
16 0.25
17 0.25
18 0.33
19 0.43
20 0.45
21 0.47
22 0.5
23 0.55
24 0.53
25 0.57
26 0.57
27 0.57
28 0.65
29 0.67
30 0.68
31 0.7
32 0.69
33 0.67
34 0.62
35 0.59
36 0.53
37 0.49
38 0.43
39 0.4
40 0.36
41 0.33
42 0.31
43 0.24
44 0.23
45 0.25
46 0.31
47 0.35
48 0.4
49 0.41
50 0.43
51 0.49
52 0.54
53 0.57
54 0.53
55 0.51
56 0.45
57 0.44
58 0.4
59 0.33
60 0.27
61 0.21
62 0.2
63 0.17
64 0.21
65 0.21
66 0.22
67 0.25
68 0.3
69 0.36
70 0.37
71 0.4
72 0.45
73 0.52
74 0.59
75 0.65
76 0.65
77 0.61
78 0.59
79 0.56
80 0.55
81 0.53
82 0.49
83 0.49
84 0.45
85 0.43
86 0.42
87 0.4
88 0.33
89 0.3
90 0.27
91 0.21
92 0.21
93 0.23
94 0.26
95 0.31
96 0.33
97 0.34
98 0.38
99 0.4
100 0.44
101 0.47
102 0.44
103 0.41
104 0.39
105 0.36
106 0.32
107 0.29
108 0.22
109 0.15
110 0.13
111 0.11
112 0.09
113 0.09
114 0.09
115 0.11
116 0.12
117 0.14
118 0.17
119 0.2
120 0.3
121 0.38
122 0.46
123 0.5
124 0.59
125 0.69
126 0.75
127 0.82
128 0.82
129 0.79
130 0.8
131 0.81
132 0.8
133 0.76
134 0.73
135 0.7
136 0.68
137 0.63
138 0.56
139 0.51
140 0.51
141 0.54
142 0.57
143 0.54
144 0.56
145 0.61
146 0.63
147 0.67
148 0.68
149 0.68
150 0.66
151 0.71
152 0.67
153 0.62
154 0.57
155 0.51
156 0.44
157 0.37
158 0.34
159 0.3
160 0.31
161 0.36
162 0.36
163 0.39
164 0.4
165 0.41
166 0.44
167 0.47
168 0.48
169 0.5
170 0.57
171 0.59
172 0.59
173 0.62
174 0.54
175 0.48
176 0.49
177 0.45
178 0.38
179 0.34
180 0.37
181 0.33
182 0.4
183 0.39
184 0.37
185 0.34
186 0.33
187 0.3
188 0.24
189 0.23
190 0.15
191 0.19
192 0.12
193 0.13
194 0.14
195 0.14
196 0.14
197 0.14
198 0.16
199 0.15
200 0.18
201 0.17
202 0.16
203 0.16
204 0.16
205 0.17
206 0.14
207 0.11
208 0.08
209 0.07
210 0.08
211 0.09
212 0.1
213 0.1
214 0.11
215 0.12
216 0.13
217 0.14
218 0.17
219 0.17
220 0.2
221 0.18
222 0.17
223 0.17
224 0.15
225 0.15
226 0.14
227 0.14
228 0.13
229 0.15
230 0.18
231 0.23
232 0.26
233 0.28
234 0.24
235 0.25
236 0.27
237 0.27
238 0.27
239 0.23
240 0.22
241 0.22
242 0.3
243 0.34
244 0.31
245 0.3
246 0.26
247 0.27
248 0.28
249 0.28
250 0.22
251 0.2
252 0.21
253 0.27
254 0.29
255 0.35
256 0.36
257 0.36
258 0.35
259 0.37
260 0.37
261 0.37
262 0.46
263 0.47
264 0.5
265 0.52
266 0.59
267 0.58
268 0.56
269 0.52
270 0.5
271 0.46
272 0.45
273 0.47
274 0.39
275 0.35
276 0.38
277 0.38
278 0.32
279 0.32
280 0.31
281 0.29
282 0.3
283 0.33
284 0.3
285 0.28
286 0.27
287 0.23
288 0.18
289 0.2
290 0.29
291 0.28
292 0.32
293 0.34
294 0.34
295 0.35
296 0.35
297 0.32
298 0.24
299 0.23
300 0.21
301 0.17
302 0.16
303 0.16
304 0.14
305 0.14
306 0.12
307 0.1
308 0.08
309 0.08
310 0.08
311 0.06
312 0.06
313 0.06
314 0.07
315 0.07
316 0.08
317 0.08
318 0.09
319 0.09
320 0.09
321 0.09
322 0.11
323 0.11
324 0.12
325 0.13
326 0.12
327 0.12
328 0.12
329 0.1
330 0.08
331 0.08
332 0.08
333 0.08
334 0.1
335 0.1
336 0.11
337 0.11
338 0.11
339 0.12
340 0.13
341 0.12
342 0.12
343 0.15
344 0.16
345 0.16
346 0.15
347 0.14
348 0.13
349 0.15
350 0.18
351 0.21
352 0.2
353 0.23
354 0.23
355 0.24
356 0.24
357 0.23
358 0.24
359 0.24
360 0.25
361 0.25
362 0.28
363 0.29
364 0.35
365 0.37
366 0.4
367 0.39
368 0.44
369 0.46
370 0.48
371 0.47
372 0.42
373 0.43
374 0.36
375 0.37
376 0.37
377 0.39
378 0.41
379 0.46
380 0.49
381 0.48
382 0.46
383 0.42
384 0.36
385 0.33
386 0.27
387 0.22
388 0.18
389 0.15
390 0.15
391 0.16
392 0.16
393 0.14
394 0.13
395 0.12
396 0.11
397 0.12
398 0.13
399 0.1
400 0.1
401 0.1
402 0.13
403 0.12
404 0.13
405 0.13
406 0.12
407 0.13
408 0.12
409 0.13
410 0.1
411 0.12
412 0.12
413 0.14
414 0.13
415 0.13
416 0.14
417 0.14
418 0.15
419 0.14
420 0.13
421 0.1
422 0.14
423 0.19
424 0.22
425 0.28
426 0.33
427 0.42
428 0.45
429 0.45
430 0.42
431 0.44
432 0.5
433 0.54
434 0.57
435 0.56
436 0.64
437 0.69
438 0.76
439 0.8
440 0.8
441 0.79
442 0.74
443 0.73
444 0.7
445 0.67
446 0.62
447 0.57
448 0.49
449 0.4
450 0.35
451 0.28
452 0.21
453 0.19
454 0.18