Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GPX8

Protein Details
Accession Q2GPX8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
91-111GRRNRAPPPRVRYNKDGKKVVBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
92-103RRNRAPPPRVRY
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSTEGRRNRAPPPRVRYNKDGKKVVPTQNPKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.83
5 0.82
6 0.83
7 0.83
8 0.8
9 0.73
10 0.72
11 0.69
12 0.69
13 0.68
14 0.66
15 0.63
16 0.65
17 0.68
18 0.69
19 0.71
20 0.7
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.67
28 0.59
29 0.52
30 0.45
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.11
55 0.17
56 0.19
57 0.2
58 0.23
59 0.24
60 0.25
61 0.27
62 0.25
63 0.2
64 0.2
65 0.18
66 0.2
67 0.19
68 0.21
69 0.22
70 0.26
71 0.26
72 0.26
73 0.28
74 0.32
75 0.4
76 0.45
77 0.51
78 0.55
79 0.57
80 0.6
81 0.66
82 0.68
83 0.68
84 0.68
85 0.68
86 0.72
87 0.76
88 0.78
89 0.78
90 0.79
91 0.81
92 0.8
93 0.79
94 0.7
95 0.71
96 0.73
97 0.74
98 0.73
99 0.73