Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SWJ6

Protein Details
Accession F2SWJ6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-115KRLCEGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLGLRSLLSTPSKLPLSQFTSVLPRSICRTAFIRAFSQASGANLSTKSIWRTSETLSTVLKNLCSKGVQSFGQTRGMKTRSSVKRLCEGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.32
4 0.32
5 0.31
6 0.28
7 0.32
8 0.32
9 0.33
10 0.26
11 0.22
12 0.25
13 0.28
14 0.27
15 0.23
16 0.25
17 0.27
18 0.29
19 0.3
20 0.27
21 0.26
22 0.26
23 0.23
24 0.22
25 0.18
26 0.16
27 0.15
28 0.13
29 0.11
30 0.1
31 0.11
32 0.1
33 0.11
34 0.12
35 0.12
36 0.13
37 0.14
38 0.16
39 0.18
40 0.21
41 0.21
42 0.21
43 0.2
44 0.19
45 0.18
46 0.17
47 0.17
48 0.13
49 0.12
50 0.11
51 0.11
52 0.12
53 0.12
54 0.15
55 0.14
56 0.16
57 0.2
58 0.2
59 0.29
60 0.28
61 0.28
62 0.31
63 0.32
64 0.29
65 0.28
66 0.36
67 0.35
68 0.42
69 0.46
70 0.42
71 0.49
72 0.53
73 0.54
74 0.52
75 0.53
76 0.55
77 0.6
78 0.65
79 0.66
80 0.73
81 0.78
82 0.77
83 0.79
84 0.8
85 0.79
86 0.78
87 0.78
88 0.76
89 0.77
90 0.79
91 0.75
92 0.75
93 0.77
94 0.81
95 0.82