Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SCL8

Protein Details
Accession F2SCL8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
231-251DLEHECKSRIKERRRRKAVVSBasic
NLS Segment(s)
PositionSequence
239-247RIKERRRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGNPARSRSGSGASHYGMGDDEGSVLGTGLTSRQLEAFGRKVTTTASHLMSTTTDPTVSAHYQAAMSGIQRELRRPGAQRRMFAFAQTTPTELVRSKFSTSEIQYRALSSLPDDLLQHLPEDTSTYSLFQGFQASIHDADNEHRKSHRRRSSHGQKRLEDVDRNTGALPPTIGHLKRERDSLNHRLEMMGVRKNMCSAEIHEIDNKIMNLNKMRKIVLDRLAGLEMDEADLEHECKSRIKERRRRKAVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.29
4 0.26
5 0.2
6 0.18
7 0.14
8 0.09
9 0.09
10 0.06
11 0.07
12 0.06
13 0.06
14 0.05
15 0.04
16 0.04
17 0.05
18 0.08
19 0.08
20 0.08
21 0.09
22 0.11
23 0.13
24 0.18
25 0.21
26 0.21
27 0.22
28 0.22
29 0.22
30 0.22
31 0.23
32 0.22
33 0.22
34 0.21
35 0.2
36 0.2
37 0.21
38 0.2
39 0.19
40 0.17
41 0.14
42 0.12
43 0.11
44 0.12
45 0.16
46 0.15
47 0.15
48 0.13
49 0.13
50 0.13
51 0.13
52 0.13
53 0.09
54 0.09
55 0.09
56 0.09
57 0.13
58 0.14
59 0.16
60 0.19
61 0.23
62 0.27
63 0.31
64 0.39
65 0.46
66 0.49
67 0.51
68 0.51
69 0.52
70 0.48
71 0.43
72 0.36
73 0.26
74 0.27
75 0.23
76 0.21
77 0.16
78 0.16
79 0.17
80 0.16
81 0.16
82 0.15
83 0.17
84 0.17
85 0.17
86 0.19
87 0.23
88 0.24
89 0.3
90 0.28
91 0.29
92 0.28
93 0.28
94 0.26
95 0.21
96 0.18
97 0.11
98 0.11
99 0.09
100 0.09
101 0.09
102 0.1
103 0.11
104 0.11
105 0.1
106 0.08
107 0.08
108 0.07
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.09
117 0.07
118 0.08
119 0.07
120 0.07
121 0.07
122 0.08
123 0.09
124 0.08
125 0.08
126 0.08
127 0.1
128 0.18
129 0.18
130 0.19
131 0.21
132 0.29
133 0.36
134 0.47
135 0.53
136 0.5
137 0.55
138 0.65
139 0.73
140 0.76
141 0.78
142 0.76
143 0.69
144 0.68
145 0.68
146 0.62
147 0.55
148 0.47
149 0.45
150 0.38
151 0.37
152 0.32
153 0.28
154 0.23
155 0.19
156 0.16
157 0.09
158 0.1
159 0.15
160 0.16
161 0.18
162 0.23
163 0.28
164 0.3
165 0.35
166 0.35
167 0.36
168 0.43
169 0.48
170 0.49
171 0.45
172 0.43
173 0.38
174 0.38
175 0.36
176 0.33
177 0.29
178 0.25
179 0.25
180 0.24
181 0.26
182 0.25
183 0.2
184 0.18
185 0.16
186 0.22
187 0.23
188 0.24
189 0.26
190 0.27
191 0.26
192 0.27
193 0.24
194 0.18
195 0.19
196 0.21
197 0.27
198 0.32
199 0.37
200 0.37
201 0.38
202 0.39
203 0.43
204 0.46
205 0.45
206 0.42
207 0.38
208 0.37
209 0.37
210 0.33
211 0.28
212 0.21
213 0.14
214 0.11
215 0.09
216 0.07
217 0.07
218 0.08
219 0.08
220 0.09
221 0.1
222 0.11
223 0.16
224 0.22
225 0.3
226 0.4
227 0.5
228 0.59
229 0.7
230 0.8
231 0.85