Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SKE8

Protein Details
Accession F2SKE8   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
507-526KQSPRMSKPMTKRQKLSATPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029005  LIM-bd/SEUSS  
Pfam View protein in Pfam  
PF01803  LIM_bind  
Amino Acid Sequences MMMAQPFPAPQVGMAHHPGMVQNHPMAPGQHPAAAHLAAQAPGGGMMQQVHAGVSAPGAPQASQPGPMAAGMQPVSGPGGPGPNAHTLSHLGPAHSHQMFQSPHLAQNLQQAQQQQQHVQQAQQQQQAQQQQQQQQQTGQPQPQPQPQPQHAGIPASMPNGTQAVTSAHMAVAQAGNPVMHPGNLPPHIQQQLQAQNHHNQAPNLHQQQQHLFAMQMAHQNSAAAQAQAQAQAQAQAQAQQQNAQQRTTQAQAMHDSQGGTPHPQPQHQQPPGTSAPSQQPGIPPTSQAGPQQQQQQSQQGPTPQPTPGQHVGPPQQLAGPEGQMRMAQQQAAMQQMMMQQRMPNPMKGSSIFRLFSFAENLSGYSNRNPAPGLPYWQNFVEQFYAPNGVLRLVVFNAQRGTKQFEISTPALARYYWTQFTSGIKQIQMIVENVAEKDLPTGGQIVESQKTSFIYWFENGCQLVSTGTLVAQYGPTGKIELLDIGTGGHTEYIPRHQLQPPPSPEQKQSPRMSKPMTKRQKLSATPSVAIPDSMVTDDGVPVAVMSFLEVGCLRTFQAGNES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.23
4 0.23
5 0.25
6 0.24
7 0.25
8 0.24
9 0.23
10 0.23
11 0.24
12 0.26
13 0.25
14 0.24
15 0.27
16 0.25
17 0.25
18 0.23
19 0.24
20 0.25
21 0.23
22 0.21
23 0.18
24 0.17
25 0.15
26 0.15
27 0.13
28 0.1
29 0.09
30 0.09
31 0.07
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.1
48 0.16
49 0.17
50 0.17
51 0.18
52 0.17
53 0.17
54 0.17
55 0.17
56 0.12
57 0.15
58 0.13
59 0.12
60 0.11
61 0.11
62 0.13
63 0.11
64 0.11
65 0.08
66 0.11
67 0.12
68 0.13
69 0.16
70 0.2
71 0.22
72 0.22
73 0.23
74 0.22
75 0.23
76 0.29
77 0.26
78 0.21
79 0.2
80 0.23
81 0.28
82 0.26
83 0.25
84 0.19
85 0.25
86 0.26
87 0.26
88 0.31
89 0.25
90 0.29
91 0.31
92 0.31
93 0.25
94 0.34
95 0.37
96 0.31
97 0.31
98 0.31
99 0.33
100 0.39
101 0.41
102 0.35
103 0.35
104 0.41
105 0.4
106 0.4
107 0.4
108 0.42
109 0.46
110 0.48
111 0.45
112 0.42
113 0.46
114 0.52
115 0.5
116 0.48
117 0.48
118 0.49
119 0.54
120 0.55
121 0.51
122 0.47
123 0.48
124 0.49
125 0.48
126 0.46
127 0.44
128 0.46
129 0.49
130 0.54
131 0.55
132 0.54
133 0.56
134 0.54
135 0.57
136 0.51
137 0.5
138 0.44
139 0.4
140 0.33
141 0.27
142 0.25
143 0.19
144 0.18
145 0.13
146 0.12
147 0.11
148 0.11
149 0.08
150 0.08
151 0.08
152 0.09
153 0.1
154 0.09
155 0.08
156 0.09
157 0.09
158 0.09
159 0.08
160 0.07
161 0.07
162 0.06
163 0.06
164 0.06
165 0.08
166 0.07
167 0.07
168 0.07
169 0.08
170 0.14
171 0.16
172 0.17
173 0.17
174 0.23
175 0.26
176 0.25
177 0.26
178 0.28
179 0.35
180 0.36
181 0.39
182 0.37
183 0.4
184 0.43
185 0.45
186 0.4
187 0.31
188 0.3
189 0.32
190 0.37
191 0.35
192 0.37
193 0.36
194 0.36
195 0.38
196 0.41
197 0.35
198 0.27
199 0.23
200 0.19
201 0.17
202 0.17
203 0.19
204 0.14
205 0.14
206 0.14
207 0.14
208 0.13
209 0.14
210 0.13
211 0.08
212 0.07
213 0.08
214 0.09
215 0.11
216 0.11
217 0.09
218 0.08
219 0.1
220 0.1
221 0.11
222 0.1
223 0.13
224 0.15
225 0.18
226 0.18
227 0.19
228 0.21
229 0.26
230 0.28
231 0.25
232 0.24
233 0.22
234 0.24
235 0.23
236 0.24
237 0.17
238 0.17
239 0.2
240 0.21
241 0.2
242 0.18
243 0.17
244 0.14
245 0.15
246 0.15
247 0.14
248 0.14
249 0.19
250 0.19
251 0.21
252 0.24
253 0.29
254 0.39
255 0.39
256 0.4
257 0.35
258 0.39
259 0.38
260 0.38
261 0.3
262 0.23
263 0.23
264 0.23
265 0.23
266 0.18
267 0.18
268 0.17
269 0.2
270 0.17
271 0.14
272 0.13
273 0.14
274 0.15
275 0.15
276 0.18
277 0.18
278 0.21
279 0.29
280 0.3
281 0.33
282 0.33
283 0.37
284 0.34
285 0.33
286 0.32
287 0.28
288 0.27
289 0.26
290 0.25
291 0.2
292 0.22
293 0.22
294 0.27
295 0.25
296 0.25
297 0.24
298 0.27
299 0.3
300 0.29
301 0.28
302 0.22
303 0.2
304 0.19
305 0.18
306 0.14
307 0.11
308 0.1
309 0.09
310 0.1
311 0.09
312 0.09
313 0.1
314 0.1
315 0.09
316 0.08
317 0.1
318 0.11
319 0.12
320 0.11
321 0.09
322 0.1
323 0.14
324 0.15
325 0.14
326 0.14
327 0.14
328 0.16
329 0.25
330 0.26
331 0.24
332 0.24
333 0.25
334 0.27
335 0.27
336 0.29
337 0.24
338 0.27
339 0.25
340 0.22
341 0.24
342 0.23
343 0.22
344 0.2
345 0.17
346 0.15
347 0.14
348 0.15
349 0.12
350 0.13
351 0.13
352 0.12
353 0.16
354 0.15
355 0.16
356 0.15
357 0.15
358 0.19
359 0.19
360 0.22
361 0.22
362 0.23
363 0.25
364 0.25
365 0.26
366 0.21
367 0.22
368 0.19
369 0.15
370 0.15
371 0.14
372 0.15
373 0.13
374 0.14
375 0.12
376 0.1
377 0.1
378 0.09
379 0.09
380 0.08
381 0.12
382 0.11
383 0.13
384 0.15
385 0.15
386 0.17
387 0.18
388 0.24
389 0.22
390 0.24
391 0.22
392 0.22
393 0.27
394 0.27
395 0.28
396 0.22
397 0.22
398 0.2
399 0.19
400 0.19
401 0.17
402 0.21
403 0.19
404 0.19
405 0.2
406 0.21
407 0.25
408 0.28
409 0.29
410 0.28
411 0.25
412 0.25
413 0.26
414 0.26
415 0.24
416 0.19
417 0.15
418 0.13
419 0.14
420 0.13
421 0.12
422 0.1
423 0.08
424 0.09
425 0.08
426 0.07
427 0.07
428 0.08
429 0.07
430 0.09
431 0.11
432 0.13
433 0.15
434 0.16
435 0.15
436 0.15
437 0.17
438 0.17
439 0.16
440 0.15
441 0.16
442 0.18
443 0.19
444 0.19
445 0.22
446 0.22
447 0.2
448 0.19
449 0.15
450 0.13
451 0.12
452 0.11
453 0.07
454 0.07
455 0.07
456 0.07
457 0.07
458 0.07
459 0.07
460 0.08
461 0.09
462 0.09
463 0.1
464 0.1
465 0.1
466 0.1
467 0.11
468 0.1
469 0.09
470 0.09
471 0.08
472 0.08
473 0.07
474 0.07
475 0.06
476 0.05
477 0.07
478 0.09
479 0.15
480 0.2
481 0.22
482 0.27
483 0.32
484 0.39
485 0.44
486 0.52
487 0.52
488 0.56
489 0.61
490 0.61
491 0.61
492 0.65
493 0.68
494 0.67
495 0.7
496 0.71
497 0.71
498 0.74
499 0.76
500 0.75
501 0.76
502 0.77
503 0.8
504 0.79
505 0.77
506 0.78
507 0.81
508 0.78
509 0.77
510 0.75
511 0.7
512 0.62
513 0.58
514 0.53
515 0.43
516 0.36
517 0.28
518 0.19
519 0.15
520 0.14
521 0.13
522 0.1
523 0.1
524 0.1
525 0.1
526 0.09
527 0.07
528 0.06
529 0.06
530 0.05
531 0.05
532 0.05
533 0.06
534 0.06
535 0.08
536 0.09
537 0.1
538 0.11
539 0.12
540 0.12
541 0.15
542 0.16