Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WK10

Protein Details
Accession A0A080WK10   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-102LYGIIKMAKRQKKYSKKQQPMLYIPAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, extr 5, nucl 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTGIQPRTKISLLWLLLWYSCLQTLAAPGIKGARLGYEDSKGPRCTGIEEGMTQQLVPYIWLNTGKKQHSSWETSLYGIIKMAKRQKKYSKKQQPMLYIPAFGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.23
4 0.23
5 0.2
6 0.13
7 0.12
8 0.1
9 0.09
10 0.08
11 0.09
12 0.12
13 0.12
14 0.11
15 0.11
16 0.12
17 0.12
18 0.12
19 0.11
20 0.08
21 0.08
22 0.11
23 0.12
24 0.13
25 0.15
26 0.18
27 0.23
28 0.22
29 0.21
30 0.2
31 0.19
32 0.19
33 0.19
34 0.18
35 0.14
36 0.14
37 0.15
38 0.14
39 0.13
40 0.11
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.07
48 0.12
49 0.13
50 0.17
51 0.24
52 0.25
53 0.27
54 0.28
55 0.33
56 0.34
57 0.39
58 0.37
59 0.36
60 0.35
61 0.32
62 0.33
63 0.27
64 0.22
65 0.17
66 0.2
67 0.16
68 0.22
69 0.31
70 0.37
71 0.42
72 0.51
73 0.61
74 0.68
75 0.77
76 0.82
77 0.84
78 0.87
79 0.9
80 0.89
81 0.88
82 0.83
83 0.81
84 0.71