Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F2SZZ4

Protein Details
Accession F2SZZ4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29APSASAGGKKQKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) mito 13, mito_nucl 12, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSASAGGKKQKKKWSKGKVKDKAVHAVVLDKTTSEKLYKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKMNIYSMSTLLPDLQHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.84
4 0.87
5 0.89
6 0.92
7 0.92
8 0.92
9 0.88
10 0.82
11 0.79
12 0.69
13 0.6
14 0.49
15 0.44
16 0.34
17 0.28
18 0.23
19 0.15
20 0.15
21 0.14
22 0.15
23 0.12
24 0.11
25 0.13
26 0.2
27 0.22
28 0.24
29 0.26
30 0.28
31 0.32
32 0.33
33 0.3
34 0.25
35 0.22
36 0.18
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.15
52 0.16
53 0.15
54 0.15
55 0.16
56 0.14
57 0.14
58 0.13
59 0.14
60 0.19
61 0.2
62 0.2
63 0.21
64 0.21
65 0.2
66 0.24
67 0.3
68 0.34
69 0.37
70 0.42
71 0.42
72 0.49
73 0.5
74 0.47
75 0.39
76 0.31
77 0.29
78 0.24
79 0.22
80 0.15
81 0.13
82 0.13