Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A080WPG4

Protein Details
Accession A0A080WPG4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-109VLQGYKYRLKGRKRQRDSSYRALEQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 5, extr 5, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MPARRFVSTRFLSYCIMMSLVSLLLELSKMLWPSRLSPSPSLLLCPLLHAENRVETRNHFHKLYNTHVILKSLHKHSYFLSRTVVLQGYKYRLKGRKRQRDSSYRALEQRQSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.24
3 0.21
4 0.15
5 0.12
6 0.1
7 0.08
8 0.07
9 0.06
10 0.05
11 0.04
12 0.05
13 0.04
14 0.05
15 0.06
16 0.07
17 0.08
18 0.11
19 0.12
20 0.15
21 0.22
22 0.26
23 0.28
24 0.29
25 0.31
26 0.32
27 0.31
28 0.29
29 0.22
30 0.2
31 0.16
32 0.15
33 0.13
34 0.11
35 0.11
36 0.11
37 0.11
38 0.13
39 0.15
40 0.16
41 0.15
42 0.15
43 0.21
44 0.25
45 0.28
46 0.25
47 0.25
48 0.28
49 0.32
50 0.36
51 0.36
52 0.32
53 0.33
54 0.33
55 0.33
56 0.3
57 0.29
58 0.29
59 0.27
60 0.3
61 0.27
62 0.28
63 0.28
64 0.36
65 0.34
66 0.31
67 0.3
68 0.26
69 0.26
70 0.27
71 0.29
72 0.19
73 0.2
74 0.21
75 0.25
76 0.27
77 0.3
78 0.36
79 0.41
80 0.49
81 0.57
82 0.64
83 0.7
84 0.75
85 0.82
86 0.84
87 0.86
88 0.86
89 0.86
90 0.84
91 0.8
92 0.77
93 0.73