Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SW04

Protein Details
Accession F2SW04    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTARKTKRGVEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
6-27TTARKTKRGVEKKKKDPNAPKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTARKTKRGVEKKKKDPNAPKRGLSAYMIFANEQRAAVREENPNITFGQVGKVLGERWKALSDKQRVPYEEKAATDKQRYEDEKAAYNSRQDDDESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.86
4 0.87
5 0.93
6 0.92
7 0.91
8 0.91
9 0.91
10 0.91
11 0.86
12 0.78
13 0.71
14 0.65
15 0.56
16 0.47
17 0.38
18 0.29
19 0.25
20 0.23
21 0.18
22 0.17
23 0.17
24 0.14
25 0.13
26 0.1
27 0.1
28 0.12
29 0.13
30 0.16
31 0.17
32 0.19
33 0.22
34 0.22
35 0.22
36 0.19
37 0.17
38 0.14
39 0.11
40 0.11
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.1
47 0.12
48 0.1
49 0.11
50 0.14
51 0.15
52 0.19
53 0.27
54 0.32
55 0.37
56 0.44
57 0.48
58 0.48
59 0.53
60 0.54
61 0.51
62 0.47
63 0.42
64 0.4
65 0.4
66 0.43
67 0.43
68 0.41
69 0.38
70 0.43
71 0.45
72 0.46
73 0.47
74 0.44
75 0.46
76 0.47
77 0.49
78 0.43
79 0.44
80 0.41
81 0.37
82 0.36