Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SLD9

Protein Details
Accession F2SLD9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-38WKIPWRLSSPQKARQRKRLRAVDNVHydrophilic
74-103DKYTIFDRKEKKYRKGIHKLPKWTRVSQRIHydrophilic
NLS Segment(s)
PositionSequence
82-95KEKKYRKGIHKLPK
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLSGLLWKIPWRLSSPQKARQRKRLRAVDNVVDTVYAALERNGLGATKPVERWYREMPREEEMLPRDKYTIFDRKEKKYRKGIHKLPKWTRVSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.21
5 0.23
6 0.3
7 0.35
8 0.45
9 0.52
10 0.59
11 0.67
12 0.76
13 0.8
14 0.83
15 0.85
16 0.84
17 0.86
18 0.87
19 0.81
20 0.8
21 0.77
22 0.73
23 0.64
24 0.55
25 0.45
26 0.34
27 0.29
28 0.2
29 0.13
30 0.07
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.06
40 0.07
41 0.08
42 0.09
43 0.13
44 0.17
45 0.18
46 0.22
47 0.28
48 0.36
49 0.38
50 0.42
51 0.41
52 0.4
53 0.41
54 0.37
55 0.34
56 0.28
57 0.31
58 0.27
59 0.25
60 0.24
61 0.22
62 0.24
63 0.26
64 0.32
65 0.29
66 0.38
67 0.44
68 0.52
69 0.62
70 0.69
71 0.71
72 0.72
73 0.79
74 0.8
75 0.85
76 0.85
77 0.86
78 0.86
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79