Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A080WN40

Protein Details
Accession A0A080WN40    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAKANKRLKKSRQPARPARAQQPKNHydrophilic
NLS Segment(s)
PositionSequence
5-19NKRLKKSRQPARPAR
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 6
Family & Domain DBs
Amino Acid Sequences MAKANKRLKKSRQPARPARAQQPKNADERPSTALFLCVLALCRRGRGFTAPAVQPITAGKSPPPLRPRMQEAMRIMKDGARNRLGRVGEPSSCHGPTSIGIIIIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.88
4 0.84
5 0.84
6 0.84
7 0.77
8 0.74
9 0.72
10 0.68
11 0.64
12 0.61
13 0.53
14 0.45
15 0.45
16 0.43
17 0.35
18 0.31
19 0.25
20 0.22
21 0.19
22 0.17
23 0.13
24 0.08
25 0.09
26 0.08
27 0.12
28 0.11
29 0.13
30 0.14
31 0.14
32 0.15
33 0.17
34 0.18
35 0.17
36 0.22
37 0.2
38 0.21
39 0.21
40 0.2
41 0.17
42 0.15
43 0.16
44 0.11
45 0.11
46 0.1
47 0.17
48 0.2
49 0.26
50 0.3
51 0.31
52 0.35
53 0.39
54 0.45
55 0.45
56 0.45
57 0.46
58 0.46
59 0.51
60 0.48
61 0.44
62 0.38
63 0.33
64 0.37
65 0.35
66 0.37
67 0.34
68 0.35
69 0.35
70 0.41
71 0.39
72 0.35
73 0.36
74 0.34
75 0.3
76 0.32
77 0.35
78 0.34
79 0.34
80 0.32
81 0.26
82 0.23
83 0.21
84 0.23
85 0.19