Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2SST3

Protein Details
Accession F2SST3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPVVKVIRSRRKRKYWASLDCFNKRTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 13.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MPVVKVIRSRRKRKYWASLDCFNKRTTLRTVMREYRMYNKRAFHYYNCNTEDDNPSAVVWIVRPYFQNCKVFLLRGSFRLPNYEWLISNPGREYRVKGEDRIALCGSKTAVVVIEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.9
4 0.86
5 0.85
6 0.83
7 0.8
8 0.72
9 0.62
10 0.56
11 0.47
12 0.44
13 0.4
14 0.41
15 0.39
16 0.43
17 0.51
18 0.53
19 0.56
20 0.55
21 0.52
22 0.53
23 0.53
24 0.5
25 0.47
26 0.44
27 0.43
28 0.45
29 0.46
30 0.4
31 0.44
32 0.45
33 0.48
34 0.45
35 0.43
36 0.37
37 0.37
38 0.37
39 0.28
40 0.24
41 0.17
42 0.15
43 0.14
44 0.13
45 0.1
46 0.06
47 0.07
48 0.07
49 0.08
50 0.09
51 0.12
52 0.18
53 0.23
54 0.27
55 0.25
56 0.3
57 0.3
58 0.3
59 0.29
60 0.29
61 0.25
62 0.24
63 0.27
64 0.25
65 0.24
66 0.28
67 0.27
68 0.26
69 0.29
70 0.28
71 0.25
72 0.24
73 0.3
74 0.26
75 0.27
76 0.24
77 0.22
78 0.23
79 0.24
80 0.26
81 0.27
82 0.35
83 0.36
84 0.37
85 0.39
86 0.42
87 0.42
88 0.43
89 0.38
90 0.3
91 0.27
92 0.27
93 0.23
94 0.18
95 0.17
96 0.12
97 0.12