Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q1J8

Protein Details
Accession A8Q1J8    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-119PLDLRPKKTRALRRKMTKYEVSQRTERKHKKDVHFGVRRYBasic
NLS Segment(s)
PositionSequence
77-77K
80-110PLDLRPKKTRALRRKMTKYEVSQRTERKHKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG mgl:MGL_1799  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVRTQDLQNKSKADLLNQVAELRKELLQLRVQKVAGGASSKLARIHTVRKNIARVLTVINLKQRANMREFYKGKKFQPLDLRPKKTRALRRKMTKYEVSQRTERKHKKDVHFGVRRYVLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.41
4 0.36
5 0.34
6 0.32
7 0.33
8 0.3
9 0.29
10 0.28
11 0.22
12 0.19
13 0.18
14 0.19
15 0.21
16 0.25
17 0.31
18 0.33
19 0.35
20 0.35
21 0.33
22 0.31
23 0.27
24 0.22
25 0.16
26 0.13
27 0.11
28 0.12
29 0.13
30 0.13
31 0.13
32 0.14
33 0.16
34 0.24
35 0.27
36 0.34
37 0.38
38 0.4
39 0.43
40 0.42
41 0.41
42 0.33
43 0.28
44 0.22
45 0.21
46 0.19
47 0.17
48 0.18
49 0.19
50 0.18
51 0.21
52 0.23
53 0.23
54 0.24
55 0.28
56 0.27
57 0.34
58 0.37
59 0.39
60 0.45
61 0.47
62 0.46
63 0.51
64 0.5
65 0.47
66 0.55
67 0.58
68 0.61
69 0.65
70 0.71
71 0.66
72 0.69
73 0.7
74 0.68
75 0.7
76 0.69
77 0.7
78 0.72
79 0.79
80 0.85
81 0.85
82 0.84
83 0.81
84 0.79
85 0.79
86 0.77
87 0.72
88 0.7
89 0.7
90 0.71
91 0.75
92 0.76
93 0.73
94 0.74
95 0.78
96 0.79
97 0.82
98 0.83
99 0.83
100 0.83
101 0.77
102 0.77
103 0.75